MD5: cdfa3b533557cb8b308072973646bdcb
SHA1: 86696e3e46bf0201c4a2eebccb0b5b828676c99d
SHA256: 99325b7ceccbc03a15a6d1e36be9ce25641929bb28faf7728ff936bddfb99fd0
SSDeep: 98304:g5wWPD2BOmTsqF50saTw40Yua7RlFkYAig0xSFIfufOpZCXtlVohfpvQR83Ss 7w:p62B1TLAJjilpt/OXCXWBvQR0h 7w
Size: 5558160 bytes
File type: EXE
Platform: WIN32
Entropy: Packed
PEID: UPolyXv05_v6
Company: Applications Install
Created at: 2011-11-02 15:24:41
Analyzed on: WindowsXP SP3 32-bit

Summary:

Trojan. A program that appears to do one thing but actually does another (a.k.a. Trojan Horse).

Payload

Process activity

The Trojan creates the following process(es):

taskkill.exe:392
taskkill.exe:192
VNC_bypauth.exe:192
Skype.exe:180
Skype.exe:1624
regedit.exe:416
agentsvr.exe:184
%original file name%.exe:436
vbc.exe:1012

The Trojan injects its code into the following process(es):

VNC_bypauth.exe:1920
mircpsy.exe:632
AdvOR.exe:120

File activity

The process VNC_bypauth.exe:1920 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\VNC_bypauth.txt (220 bytes)

The process VNC_bypauth.exe:192 makes changes in the file system.
The Trojan deletes the following file(s):

%Documents and Settings%\%current user%\Application Data\csrss.exe (0 bytes)

The process Skype.exe:1624 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\Application Data\csrss.exe (3073 bytes)

The process %original file name%.exe:436 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\AdvOR.exe (39796 bytes)
%Documents and Settings%\%current user%\system\files\proxy\05-04-2014.s4 (2 bytes)
%Documents and Settings%\%current user%\system\files\proxy\05-04-2014.s5 (638 bytes)
%Documents and Settings%\%current user%\clxtshar.dll (31 bytes)
%Documents and Settings%\%current user%\msvcr71.dll (3906 bytes)
%Documents and Settings%\%current user%\system\script\psyBNC\script3.SCRIPT (18 bytes)
%Documents and Settings%\%current user%\system\script\psyBNC\pid.dll (2330 bytes)
%Documents and Settings%\%current user%\libeay32.dll (10404 bytes)
%Documents and Settings%\%current user%\ValidProxy.txt (6 bytes)
%Documents and Settings%\%current user%\sock4.txt (100 bytes)
%Documents and Settings%\%current user%\system\script\script1.SCRIPT (10 bytes)
%Documents and Settings%\%current user%\system\files\DEF (17 bytes)
%Documents and Settings%\%current user%\Restarter.exe.config (798 bytes)
%Documents and Settings%\%current user%\AdvOR.dll (2712 bytes)
%Documents and Settings%\%current user%\system\files\users\default.ini (1 bytes)
%Documents and Settings%\%current user%\system\script\psyBNC\script6.SCRIPT (2104 bytes)
%Documents and Settings%\%current user%\mircpsy.exe (20570 bytes)
%Documents and Settings%\%current user%\system\SERVERS.ini (1 bytes)
%Documents and Settings%\%current user%\sock5.txt (100 bytes)
%Documents and Settings%\%current user%\Skype.exe (9446 bytes)
%Documents and Settings%\%current user%\system\script\script4.SCRIPT (10 bytes)
%Documents and Settings%\%current user%\x.exe (14 bytes)
%Documents and Settings%\%current user%\Interop.IWshRuntimeLibrary.dll (1568 bytes)
%Documents and Settings%\%current user%\mstsc.exe (3520 bytes)
%Documents and Settings%\%current user%\Reg_mIRC.reg (303 bytes)
%Documents and Settings%\%current user%\system\script\script2.SCRIPT (1 bytes)
%Documents and Settings%\%current user%\zlib1.dll (1568 bytes)
%Documents and Settings%\%current user%\control.ini (79 bytes)
%Documents and Settings%\%current user%\msvcrt.dll (3278 bytes)
%Documents and Settings%\%current user%\libssl32.dll (2382 bytes)
%Documents and Settings%\%current user%\autoid (431 bytes)
%Documents and Settings%\%current user%\system\script\script7.SCRIPT (9 bytes)
%Documents and Settings%\%current user%\system\POPUPS.INI (76 bytes)
%Documents and Settings%\%current user%\country.ini (3 bytes)
%Documents and Settings%\%current user%\paste.dat (768 bytes)
%Documents and Settings%\%current user%\tclient.dll (28 bytes)
%Documents and Settings%\%current user%\system\ALIASES.INI (11 bytes)
%Documents and Settings%\%current user%\mirc.ini (4 bytes)
%Documents and Settings%\%current user%\logtext.exe (2300 bytes)
%Documents and Settings%\%current user%\ssleay32.dll (2304 bytes)
%Documents and Settings%\%current user%\system\script\psyBNC\script4.SCRIPT (1 bytes)
%Documents and Settings%\%current user%\mstsweb.cat (7 bytes)
%Documents and Settings%\%current user%\VNC_bypauth.exe (1568 bytes)
%Documents and Settings%\%current user%\AdvOR.ini (2 bytes)
%Documents and Settings%\%current user%\leet (18 bytes)
%Documents and Settings%\%current user%\perform.ini (51 bytes)
%Documents and Settings%\%current user%\dict (31 bytes)
%Documents and Settings%\%current user%\mPasteBin 2.1.3.ini (7 bytes)
%Documents and Settings%\%current user%\Restarter.exe (4528 bytes)
%Documents and Settings%\%current user%\cscomp.dll (6072 bytes)
%Documents and Settings%\%current user%\mstsweb.cat.000 (7 bytes)
%Documents and Settings%\%current user%\system\files\servers\dal (145 bytes)
%Documents and Settings%\%current user%\tsgrinder.exe (2108 bytes)
%Documents and Settings%\%current user%\mstscax.dll (8160 bytes)
%Documents and Settings%\%current user%\system\script\psyBNC\script5.SCRIPT (3 bytes)
%Documents and Settings%\%current user%\system\files\proxy\05-04-2014.pxy (24 bytes)
%Documents and Settings%\%current user%\1strun.bat (159 bytes)

The process vbc.exe:1012 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\My Documents\Skype.exe (7547 bytes)

The process mircpsy.exe:632 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\autoid (917 bytes)
%Documents and Settings%\%current user%\system\files\users\default.ini (2656 bytes)
%Documents and Settings%\%current user%\system\SERVERS.ini (2086 bytes)
%Documents and Settings%\%current user%\system\mirc1.tm_ (361 bytes)
%Documents and Settings%\%current user%\mirc.ini (16980 bytes)
%Documents and Settings%\%current user%\system\mirc0.tm_ (740 bytes)

The Trojan deletes the following file(s):

%Documents and Settings%\%current user%\system\mirc1.tm_ (0 bytes)
%Documents and Settings%\%current user%\system\mirc0.tm_ (0 bytes)

The process AdvOR.exe:120 makes changes in the file system.
The Trojan creates and/or writes to the following file(s):

%Documents and Settings%\%current user%\AdvOR-cached-certs (3764 bytes)
%Documents and Settings%\%current user%\AdvOR-cached-consensus (7386 bytes)
%Documents and Settings%\%current user%\AdvOR-cached-descriptors.tmp (10870192 bytes)
%Documents and Settings%\%current user%\AdvOR-cached-descriptors.new (2157486 bytes)

The Trojan deletes the following file(s):

%Documents and Settings%\%current user%\AdvOR-cached-descriptors (0 bytes)

Registry activity

The process taskkill.exe:392 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "45 6B 0D 61 DA 7A 66 9B 22 6B 0E C8 93 E3 E1 F3"

The process taskkill.exe:192 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "73 A0 C5 68 24 7F 45 34 71 66 11 20 09 AC 3A FA"

The process VNC_bypauth.exe:192 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "46 31 44 6E 5C 93 E6 1F F1 EA 8D E8 A9 75 35 70"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd73-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cookies" = "%Documents and Settings%\%current user%\Cookies"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Common Documents" = "%Documents and Settings%\All Users\Documents"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Desktop" = "%Documents and Settings%\%current user%\Desktop"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd72-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{b98117e8-75ca-11e2-81b2-000c293708fb}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"AppData" = "%Documents and Settings%\%current user%\Application Data"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Common Desktop" = "%Documents and Settings%\All Users\Desktop"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd75-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cache" = "%Documents and Settings%\%current user%\Local Settings\Temporary Internet Files"

"Personal" = "%Documents and Settings%\%current user%\My Documents"

The Trojan modifies IE settings for security zones to map all local web-nodes with no dots which do not refer to any zone to the Intranet Zone:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap]
"UNCAsIntranet" = "1"

The Trojan modifies IE settings for security zones to map all urls to the Intranet Zone:

"IntranetName" = "1"

The Trojan modifies IE settings for security zones to map all web-nodes that bypassing the proxy to the Intranet Zone:

"ProxyBypass" = "1"

The process Skype.exe:180 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "51 A3 12 CE AC 0B EA 99 03 3E 2D 99 5E 7F 4F 36"

The process Skype.exe:1624 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "B8 58 C4 D4 2A B2 BA 64 2F 46 91 C0 6B 53 C8 66"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd73-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cookies" = "%Documents and Settings%\%current user%\Cookies"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Common Documents" = "%Documents and Settings%\All Users\Documents"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Desktop" = "%Documents and Settings%\%current user%\Desktop"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd72-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{b98117e8-75ca-11e2-81b2-000c293708fb}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"AppData" = "%Documents and Settings%\%current user%\Application Data"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Common Desktop" = "%Documents and Settings%\All Users\Desktop"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd75-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cache" = "%Documents and Settings%\%current user%\Local Settings\Temporary Internet Files"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%Documents and Settings%\%current user%\Application Data]
"csrss.exe" = "Skype"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Personal" = "%Documents and Settings%\%current user%\My Documents"

The Trojan modifies IE settings for security zones to map all local web-nodes with no dots which do not refer to any zone to the Intranet Zone:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap]
"UNCAsIntranet" = "1"

The Trojan modifies IE settings for security zones to map all urls to the Intranet Zone:

"IntranetName" = "1"

The Trojan modifies IE settings for security zones to map all web-nodes that bypassing the proxy to the Intranet Zone:

"ProxyBypass" = "1"

The process regedit.exe:416 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "EE 06 4D DD 75 9F E3 EF B8 C7 37 A9 29 B3 EE 0D"

[HKCU\Software\mIRC\Validated]
"(Default)" = "1337-347150-2010"

[HKCU\Software\mIRC\License]
"(Default)" = "4000-259951"

[HKCU\Software\mIRC\UserName]
"(Default)" = "FREE4ALL"

[HKCU\Software\mIRC\LastRun]
"(Default)" = "1297961851,0"

The process agentsvr.exe:184 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKCU\Software\Microsoft\Microsoft Agent]
"UseBalloon" = "1"
"CommandsWindowLeft" = "4294967295"
"KeyHoldHotKey" = "145"
"PropertySheetPage" = "0"
"PropertySheetWidth" = "0"
"SRModeID" = "00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00"
"SpeakingSpeed" = "5"
"CommandsWindowTop" = "4294967295"
"UseCharacterFont" = "1"
"UseVoiceTips" = "1"
"CommandsWindowHeight" = "200"
"EnableSpeaking" = "1"
"VoiceEnabled" = "1"
"CommandsWindowWidth" = "200"
"PropertySheetHeight" = "0"

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "79 6C F6 41 31 E9 CF 22 73 9D C2 12 31 E9 7D 18"

[HKCU\Software\Microsoft\Microsoft Agent]
"CommandsWindowLocationSet" = "0"
"UseSoundEffects" = "1"
"PropertySheetY" = "999999"
"PropertySheetX" = "999999"
"SRTimerDelay" = "2000"
"UseBeepSRPrompt" = "1"

The process %original file name%.exe:436 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "4D 50 58 05 D6 F7 B0 D4 F8 F0 8A 2F 17 72 3B 26"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd73-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cookies" = "%Documents and Settings%\%current user%\Cookies"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd72-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd75-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%Documents and Settings%\%current user%]
"1strun.bat" = "1strun"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"AppData" = "%Documents and Settings%\%current user%\Application Data"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{b98117e8-75ca-11e2-81b2-000c293708fb}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cache" = "%Documents and Settings%\%current user%\Local Settings\Temporary Internet Files"

The Trojan modifies IE settings for security zones to map all web-nodes that bypassing the proxy to the Intranet Zone:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap]
"ProxyBypass" = "1"

The Trojan modifies IE settings for security zones to map all local web-nodes with no dots which do not refer to any zone to the Intranet Zone:

"UNCAsIntranet" = "1"

The Trojan modifies IE settings for security zones to map all urls to the Intranet Zone:

"IntranetName" = "1"

The process vbc.exe:1012 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "39 F8 93 AB F2 C7 A1 62 E5 9B 36 8C 09 00 BF 39"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd73-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cookies" = "%Documents and Settings%\%current user%\Cookies"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd72-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{b98117e8-75ca-11e2-81b2-000c293708fb}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%Documents and Settings%\%current user%\My Documents]
"Skype.exe" = "Visual Basic Command Line Compiler"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cache" = "%Documents and Settings%\%current user%\Local Settings\Temporary Internet Files"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd75-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Personal" = "%Documents and Settings%\%current user%\My Documents"

To automatically run itself each time Windows is booted, the Trojan adds the following link to its file to the system registry autorun key:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Run]
"Anti-malware Services" = "%Documents and Settings%\%current user%\My Documents\Skype.exe"

The Trojan adds the reference to itself to be executed when a user logs on:

[HKLM\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Winlogon]
"UserInit" = "%System%\userinit.exe,%Documents and Settings%\%current user%\My Documents\Skype.exe"

The Trojan modifies IE settings for security zones to map all urls to the Intranet Zone:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap]
"IntranetName" = "1"

The Trojan modifies IE settings for security zones to map all local web-nodes with no dots which do not refer to any zone to the Intranet Zone:

"UNCAsIntranet" = "1"

The Trojan modifies IE settings for security zones to map all web-nodes that bypassing the proxy to the Intranet Zone:

"ProxyBypass" = "1"

The process mircpsy.exe:632 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "C0 91 38 73 8B 92 DC E9 49 95 9F D8 65 1D 09 98"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd73-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cookies" = "%Documents and Settings%\%current user%\Cookies"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd72-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\mIRC\LastRun]
"(Default)" = "1297961851,0"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Uninstall\mIRC]
"DisplayName" = "mIRC"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{b98117e8-75ca-11e2-81b2-000c293708fb}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders]
"Cache" = "%Documents and Settings%\%current user%\Local Settings\Temporary Internet Files"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%System%]
"reg.exe" = "Registry Console Tool"

[HKCU\Software\Microsoft\Windows\CurrentVersion\Explorer\MountPoints2\{c155cd75-744b-11e2-8294-806d6172696f}]
"BaseClass" = "Drive"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%Documents and Settings%\%current user%]
"x.exe" = "x"

[HKCU\Software\Microsoft\Windows NT\CurrentVersion\Windows]
"load" = "C:\DOCUME~1\"%CurrentUserName%"\mircpsy.exe"

[HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Uninstall\mIRC]
"UninstallString" = "%Documents and Settings%\%current user%\mircpsy.exe -uninstall"

[HKCU\Software\Microsoft\Windows\ShellNoRoam\MUICache\%Documents and Settings%\%current user%]
"VNC_bypauth.exe" = "VNC Viewer Free Edition for Win32"

The Trojan modifies IE settings for security zones to map all web-nodes that bypassing the proxy to the Intranet Zone:

[HKCU\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap]
"ProxyBypass" = "1"

The Trojan modifies IE settings for security zones to map all urls to the Intranet Zone:

"IntranetName" = "1"

The Trojan modifies IE settings for security zones to map all local web-nodes with no dots which do not refer to any zone to the Intranet Zone:

"UNCAsIntranet" = "1"

The process AdvOR.exe:120 makes changes in the system registry.
The Trojan creates and/or sets the following values in system registry:

[HKLM\SOFTWARE\Microsoft\Cryptography\RNG]
"Seed" = "4A D2 28 14 90 56 39 32 76 80 B4 53 6C 38 B5 4F"

Dropped PE files

HOSTS file anomalies

No changes have been detected.

Rootkit activity

No anomalies have been detected.

Propagation

VersionInfo

Company Name: Microsoft Corp.
Product Name: Windows Update
Product Version: 11, 3, 24, 0
Legal Copyright: Copyright (c) 2014 Microsoft Corp.
Legal Trademarks:
Original Filename: EGGSFX.sfx
Internal Name: EGGSFX
File Version: 11, 3, 24, 0
File Description: Windows Update
Comments:
Language: English (United States)

PE Sections

Dropped from:

Downloaded by:

Similar by SSDeep:

Similar by Lavasoft Polymorphic Checker:

URLs

URL	IP
hxxp://www.topwebhosts.org/tools/ip-locator.php?query=193.138.244.231

IDS verdicts (Suricata alerts: Emerging Threats ET ruleset)

ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 92
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 295
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 216
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 254
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 471
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 253
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 182
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 112
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 229
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 282
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 255
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 285
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 171
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 251
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 226
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 414
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 440
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 293
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 284
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 214
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 234
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 18
ET TOR Known Tor Exit Node Traffic group 18
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 382
ET TOR Known Tor Relay/Router (Not Exit) Node Traffic group 195

Traffic

GET /tools/ip-locator.php?query=193.138.244.231 HTTP/1.1

HOST: VVV.topwebhosts.org

HTTP/1.1 200 OK

Date: Thu, 29 May 2014 08:07:30 GMT

Server: Apache/2.2.15 (CentOS)

X-Powered-By: PHP/5.4.28

Set-Cookie: PHPSESSID=4ec18bjt82rtna6jg66v8k1sl7; path=/; domain=.topwebhosts.org

Set-Cookie: f33d2ed86bd82d4c22123c9da444d8ab=MTQwMTM1MDg1MA==; expires=Fri, 29-May-2015 08:07:30 GMT; path=/; domain=.topwebhosts.org

Set-Cookie: 96b28b766b7e0699aa91c9ff3d890663=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.topwebhosts.org

Set-Cookie: 2a0d2363701f23f8a75028924a3af643=MTkzLjEzOC4yNDQuMjMx; expires=Fri, 30-May-2014 08:07:30 GMT; path=/; domain=.topwebhosts.org

Expires: 0

Last-Modified: Thu, 29 May 2014 08:07:30 GMT

Cache-Control: pre-check=0, post-check=0, max-age=0

Pragma: no-cache

Connection: close

Transfer-Encoding: chunked

Content-Type: text/html; charset=utf-8
2bb5..<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN
">..<html>..<head>..<meta http-equiv="Content-Type" 
content="text/html; charset=utf-8">..<title>IP Location Finde
r</title>..<meta name="keywords" content="ip, ip address, fin
d, find ip, location, router, dns, reverse, tcp/ip, lookup, traffic, t
raffic analysis, your address, dynamic, change, isp, internet, provide
r, inet, net, localhost">..<meta name="description" content="How
 do I find a geographical location of an IP address?">..<link re
l="stylesheet" href="../style.css" type="text/css">..<link rel="
SHORTCUT ICON" href="../favicon.ico"> ..<script type="text/javas
cript">..var g4_path      = "..";..var g4_bbs       = "bbs";..var g
4_bbs_img   = "img";..var g4_url       = "hXXp://VVV.topwebhosts.org";
..var g4_is_member = "";..var g4_is_admin  = "";..var g4_bo_table  = "
";..var g4_sca       = "";..var g4_charset   = "utf-8";..var g4_is_gec
ko  = navigator.userAgent.toLowerCase().indexOf("gecko") != -1;..var g
4_is_ie     = navigator.userAgent.toLowerCase().indexOf("msie") != -1;
..</script>..<script type="text/javascript" src="../js/common
.js"></script>..</head>..<body >..<a name="g4_
head"></a>..<div align="center">.<table width="1000"
 cellspacing="0" cellpadding="0">.  <tr> .    <td width="2
72"><a href="../"><img src="../images/common/logo.gif" bor
der="0"></a></td>.    <td width="728" align="rig
<<< skipped >>>

..............d...o.V........E.....7...,.9#..:.....9.8.....5.........3
.2............./....................._.........VVV.jutoq.com..........
.4.2...................................................#.......



....6...2..S...8.)).J......(..../'...........9........................
....0...0..$.........&2.y...0...*.H........0.1.0...U....VVV.npnaivsoyp
g.com0...140511000000Z..141225000000Z0!1.0...U....VVV.fl3yxmze6hm5wy.n
et0..0...*.H............0.......o...T....u. 3..1...N..s......H..Z]j...
...4pS.2....!....9.Gb ....~...UX..El.....8w .Y.y|.,>"G..[x....`jo..
j.;UHG...er`b"H....).o.....0...*.H..............:.C..94m.q.._^...$.Q..
..{.}p.bP.Vi.....,.z...o).w....qq..w....)YZ.;....:.......1 ...&.m.....
..1P.U..08.J.............!....m ..............}[email protected]._R..
.t....Q....c.r......~..Z.y.B.*).2JFzc^..Y.7{...3..F..;r....x.[....xt.}
.......3...b....t}.....h..9>.$!.......:h...c.......<{).....O....
...Q..A.d..!._..;A.5....he1.........&.,1..9.]$S2...}......M...(...L=z.
l..4.....b.[.A......i,.H......d...ZGCKI...%....Y.e.. >U..u..2Y...,:
eA...5.X.. ....{./..."p...5..J....i.9...u....(..9...o.A.fo.o..{.~..@.;
`&M..x. 5.G.. ....a.....8.............6...2..S...8.)).J......(..../'..
.........9............................0...0..$.........&2.y...0...*.H.
.......0.1.0...U....VVV.npnaivsoypg.com0...140511000000Z..141225000000
Z0!1.0...U....VVV.fl3yxmze6hm5wy.net0..0...*.H............0.......o...
T....u. 3..1...N..s......H..Z]j......4pS.2....!....9.Gb ....~...UX..El
.....8w .Y.y|.,>"G..[x....`jo..j.;UHG...er`b"H....).o.....0...*.H..
............:.C..94m.q.._^...$.Q....{.}p.bP.Vi.....,.z...o).w....qq..w
....)YZ.;....:.......1 ...&.m.......1P.U..08.J.............!....m ....
..........}[email protected]._R...t....Q....c.r......~..Z.y.B.*).
<<< skipped >>>


..............=o.U.9.........sPV_~.$...\.l....1. .....L-......K..(...v
..........(.Vs.......siE... m.....M]!Eq..U.l.T.l.c.....>..6ZrN..d..
............0...*P....7...<...G.be.....=..t.=...}..8...9.a.>.



..........0Vd.p]....2....0...e........:7A...>...y.i.o...7..........
..0Vd.p]....2....0...e........:7A...>...y.i.o...7....



......g.p..Jy.....).0..Q-..N.T.X....\.....o...F 84u.].2.f....q.v..*B..
J...B]a.v......P...S.......i.Fg.|_.o.5>zn.1....... ..M...(.5E...8G.
.Z. ..m$..7.....G#..cd...D. ..DT......>...H..Q...xL..y.`....



....pY}.....(.C..6...'...b.o........J....!{{..........LW.p..!.......h.
T3.x.^.....jQ....{..v.NJ...r...N...r`.(.da...............s@[...m\..e..
cL...yv...x=.X..2.i..p....|w.4....$...B...2T.....A2...C2.5.R.h..@^&.7.
..1\.-4...E.fs..\K.tb..Xc.}\....v...C.....74....A}2...U..{\.... ..4..#
..zS..,;...z.t..3...jz..7.q...<:.........n.....t...o..O.H%..e.D....
...$q......^.e...M5\A..n..8t(.:..$.."7n.k.xW...D..........uz,J.g.na...
.......O......... .Rj.....@.<.).C....N..Z..MM.a.....u..U...2......q
5u.,.p..x......_.......;.c...d.ylk.-....m\a;..I..K.:`.....n.Us.|.(>
A}/..)@.P.xA.&%......*.t..s.;......BC.O.....G.......!!.c.f.......t.C.-
.....U#...vc.W.d.1g...6<*wC..r....)...dcv....F.-[].g...mH.....'.h..
h.....9.*.6......X....A. ..p.../#B...{..... }z.;..y..)..=H3..a........
.._...qd1.e4.{......[z=J....aK.I..sh..E:.P0[@.4}..9r.F.I...~$6.././|.&
gt;.L..|...&..J...62..j!;.n.i3...6D)..#<.ag......G`..(.t|~6..7.?.&g
t;....Z3.*d.i.....E.....:.....-C..02.j7.8..~.....d..}.IOp"a.d..U.,Zt .
.3.JC..\.T..v.].w..k.V)*&D....<R{.Y.$.....0Ro.sY.r.f.....j."E...O..
2..We...{.......zIx...).......9....KUd.>%.1{...Nqk.-.ii`J.h1....}..
SK&57..p.V...R..X...s.....A..P{...C.....N.w...u..p....f.m........~.2..
[..m......R.e......f...|...>.`0{V...g.........3...%@..*G..r...].ci.
....k....NxA....av.....a.<...^..B.\].v..n*.A.6MV.7^. .L.k_...@..{_.
[email protected]:.........k...,..O....w..B....#..G.u..F.k....p...8e...
...K.. .N.7...*u.....iq...&.z..p.dr"..*...TKy....x,.X.......Y.m]".7b..
.\....0....H....o.o..4..3... [email protected].*....0.J.......ZO
<<< skipped >>>


.... .:'.g.....'...!.......Zu4q.*@).......1..bR<.........K....g Km.
5x..v.....L..n9&...3..*......#...;.F..86.....X. .#..k.4.h..:..x.@.....
>8G....../.......?..6z.....'..i...g.f....*.q.}.fW]...>......l..!
..... .|...k.._.z..fE.H.;....Z.......o....0 ..E......Q.N........;.A!.|
wY....-....Mt;.K/.D..



.... ....|..C..(Z..a..](.".B....b.0......0.Y.".L........7&.|..../.OC..
...H...Hz6g..'....L..... ....|..C..(Z..a..](.".B....b.0......0.Y.".L..
......7&.|..../.OC.....H...Hz6g..'....L...



.... ../...........y.Y.A..5.s.5]c.zM..... ...8wN.p;K...2.g......g.s...
F...



.... M..$.p.......X._.|..9c.............. ..$..........|Vd.k.G......2[
....UU.n.?.....h.W..2...{&tr...........u.X}iN)......N..l,.......~.....
e..D..t....."[email protected]|.......>..%(.zX..76.\,.(....@..(b.T.....2`%
.b..L,#...k...e.SBoZ<..d"...^]).. ......P...d/.......N..W~-.I.....6
;......II.?...3.dT|.....g.PNa.. Nb..v.6...L.....W..K3 .'g.>}...2r..
o...4._....U;....*./%..`..A...O...>1.%.V.....%..It.?..lJf.D........
`&]..f...k:.'.:..F...k.|6".."@.......7zP....W.I}W7.......w.^..K[5.:.[.
.b...../#.|.D.'.y].ud..]8!.W.......3q..K.d...h=......>m..k....y9.w.
..L.7IZ ..\.,x.`..p.wa..9..gC~....Dh..a...... M..$.p.......X._.|..9c..
............ ..$..........|Vd.k.G......2[....UU.n.?.....h.W..2...{&tr.
..........u.X}iN)......N..l,.......~.....e..D..t....."[email protected]|.....
..>..%(.zX..76.\,.(....@..(b.T.....2`%.b..L,#...k...e.SBoZ<..d".
..^]).. ......P...d/.......N..W~-.I.....6;......II.?...3.dT|.....g.PNa
.. Nb..v.6...L.....W..K3 .'g.>}...2r..o...4._....U;....*./%..`..A..
.O...>1.%.V.....%..It.?..lJf.D........`&]..f...k:.'.:..F...k.|6".."
@.......7zP....W.I}W7.......w.^..K[5.:.[..b...../#.|.D.'.y].ud..]8!.W.
......3q..K.d...h=......>m..k....y9.w...L.7IZ ..\.,x.`..p.wa..9..gC
~....Dh..a....



.... .........qU..7....9....y.....S...... .....[......Q.....n.e/...ZY,
l:b.0w6..>..x.......B|....E.S..e!C..LI...:.0v.|....P'9.h..".....7;h
<..........)Uo..^....&.9;r....&..M.T..u..g.r.2.l(?x.]........<].
.V...C.......`'g.h.."_P@$2H...~a .D.B.7DU..5..?..W......w{U....5..C^..
.5 [...Rq.9..Y%O0...i.]._...[N..R..m..x'. ......d4Hh.=<@J.#..3.T2K&
gt;.I..8.....w./H....J....*[...*.;%(......S... 05..3....;...q.!c.;....
I\...L..G......EP..h..J..(}U.S..J....\`.<b.2.m.I..e.....|......?..L
...-Bm..T...~...A..Y..Gmh:..4.K~..9F.f..*.....m.ek.E.4.*Ik..[....y....
...><q...9.7.OF...0v?R...4..`..N..oZo...y.#K.... .db.S.h;.L...|.
.*...d.y...... .V.... ......:........A...k..^...)[email protected] ....v.!s}..sp.-.
.F....a.T...m..w......Y.EH.-{nJm........T...(......n...'.K....F..L.i..
1H....jh...oR....;........]e...Z5.....8Q....<[email protected].
....[.......x..B[.....w..6.a...'...AB=.m........s*I..._?.=.v .ipJNW...
.i.....A......$.<...]...g.(.O2.sw....*Tt.T....=rJ.~&.n....\....W',.
1....m.o4.V.c}a.w...KX_7 .q..^[..);.(.k.FUMl|..{>.Q6..WR....@....|.
T..X.}.gJ..c107..}..<^uR.._x.([email protected].<nsUP".S..
.._.{g=9..ExY v...o.d..V.B,[L...6%!{F..7.....n&.~K...1.M....[<.#'..
.D......3.........c c.J>



.... ..A5.l6....~.5|...N..L..(...".%..... ..`.)jD.Zp....Ab..B.zx..~.WC
.....%1.{.b.......).l.._...kZe..H....0!n.Ng5h.ulU.0..[..`...e.`..U&.w.
#q..f..\.....&:)'.......Q#...|..k`E.W.S.O..6........O6..V.....s.......
....?gWs>-I..dE.P/.............*8..^..".Z.'....g.......KV.B.h5.....
..P.i..C.S.e.|..b..!..GuaEv4...n...n.......T....}H...T.*..."E<...8t
...q....U..0./.-.....q...h.... ...k"....s...k..,....3.y.2~1L..........
K..t....$tJ.._...1.t [email protected];)j.-!KM..7!e.....Q....
q..','..v.7...T...=d....iO0..".u..Q..........\n.j.......&.^.F].c..S.W.
.v..y./..?...}.})..[q*.z..N..j...... ..A5.l6....~.5|...N..L..(...".%..
... ..`.)jD.Zp....Ab..B.zx..~.WC.....%1.{.b.......).l.._...kZe..H....0
!n.Ng5h.ulU.0..[..`...e.`..U&.w.#q..f..\.....&:)'.......Q#...|..k`E.W.
S.O..6........O6..V.....s...........?gWs>-I..dE.P/.............*8..
^..".Z.'....g.......KV.B.h5.......P.i..C.S.e.|..b..!..GuaEv4...n...n..
.....T....}H...T.*..."E<...8t...q....U..0./.-.....q...h.... ...k"..
..s...k..,....3.y.2~1L..........K..t....$tJ.._...1.t ..t....@.........
.a......M;)j.-!KM..7!e.....Q....q..','..v.7...T...=d....iO0..".u..Q...
.......\n.j.......&.^.F].c..S.W..v..y./..?...}.})..[q*.z..N..j..>..



.... .D.y.....q`..`..b]..S.PJ7.....l..... ..........7..7.&.$~...zc....
./...r..KK.7.u.o,.?...7.'..a...E..j....\....1.3&.{......VNy..AG.{/.Q..
..9........U..uDr.r........j...0O'.-m.....:....].....w.f..|..2GF...l..
 .a|..0Z'..<..8f..\..>.....8l.Qh......ZH....?Y.....t........#?_.
...C..Z..@[email protected]. (.O\.4.....F....d......S...~.S....R...q7S..&"...
H.m].....B...L.......,".....w_.....J.....'.W.~.xX.].f4)[email protected].}.`X.I.p
..o.......E..C.Vx...t......{.b..*[email protected].`....9.........e...!\
:.....I.wD../,..!.z....D..0..-)..._.....Kk...,T..q.&B....f...d;G^,c...
Q......E..T.....s.. ...&;..[.sy$



.... Cs.L|[email protected]{L.L..%.o.B. F...d.H.... O4q\..Z`.).6....*.a..P. ...z
.[..W.....t.....L,.d.......yw..{...../"..F..........}.....O.eK..$..d.{
.}.X......j.j......;7.z......T*....E.d. C.r....u..n.......I_W......?..
4....,.,.S...9U...%.o.E..vv..*e..... (...(...W....7..>.=Pc:0......S
f.?..O.W....J.d?.F.).D.<..pM.99. ...b......>........<.w..a...
'..c0.L.AT.>S.it. n/...!...!...=.e.....v8\..N<..............f.T.
q......o.^...._.c..x...#d..V.^m.....U#........wy..].......4.S0.vGop`.z
^.BMY.s..F..D).O.(5...8f.|.....K. ^..}y...<.y.......%j..5=3l.J~...M
......S......U..u)...}.....n...<s........`]...Y.... Cs.L|[email protected]{L.
L..%.o.B. F...d.H.... O4q\..Z`.).6....*.a..P. ...z.[..W.....t.....L,.d
.......yw..{...../"..F..........}.....O.eK..$..d.{.}.X......j.j......;
7.z......T*....E.d. C.r....u..n.......I_W......?..4....,.,.S...9U...%.
o.E..vv..*e..... (...(...W....7..>.=Pc:0......Sf.?..O.W....J.d?.F.)
.D.<..pM.99. ...b......>........<.w..a...'..c0.L.AT.>S.it.
 n/...!...!...=.e.....v8\..N<..............f.T.q......o.^...._.c..x
...#d..V.^m.....U#........wy..].......4.S0.vGop`.z^.BMY.s..F..D).O.(5.
..8f.|.....K. ^..}y...<.y.......%j..5=3l.J~...M......S......U..u)..
.}.....n...<s........`]...Y..



.... ..3...Nh..9..4=.L...qe.8;*....Y..... '..5AC;:..H]...g.B.m.t/.EGq.
..NjOD\..a..U.....s..7......3......u.....!T..O..0.XEh....C...7.o......
.c...`CX..:...{.c.X.........>..q8.......%h.......].TN..>..J.B...
...........FW/t-R9........m..>EAWe..s....G...........y.Cp......q#..
;J.Z.wj.Y...>..`.?.:..6.9y.L|.......y.............;..?.*'........,W
....BK....K..tM.....kT.o"...8....a...S..R.;.'SI.%[email protected].
...g!...*..t.....c.lX......^.\.B.nh_.N..Y.@. .k.....7G..hF.b{..R..~.^J
.......j........GD<..;200B2.n.//.w... .'%..W.}.....|.g!...Z....."..
.gB....*rS7W}n..j....3.'.....b.U/.....i).



.... ..hjo=...p..l....k.9i..|../)j.3..... g2.1....ydj?e........'.....2
[email protected]@.v.TuJ...@...$..5;.1....J.3(..0mM...........d.!..hFF^n.
.Y?.'Q..m[@6.cKmj=.....p.*"....I6YD...E4.?. ......3..X}rd=V..|_,..%}..
l-.o.hG!.......V.i..V.C..!."....h... .1.m.H7...J...FO.. jb.v)..Gn....L
....R2...Qv.....o..P....[Je.Y.V.....Ku.......v(.U8|>.Ht... ..V..T.N
L.7.j.C.....J...... ..........;..-..)...U...mA.7......W..p-....b.YM..S
....Ex......<e<W........;./...............WNW\...s..J...........
....B.[5..H.6.J/...../.g(....B..} F........Z...O.qE.....o.,.J.1f....X.
[7.?.....Jj.D.#. [email protected].._.... ..hjo=...p..l....k.9i..|../)j.
3..... g2.1....ydj?e........'[email protected]@.v.TuJ...@...$..5;.1
....J.3(..0mM...........d.!..hFF^n..Y?.'Q..m[@6.cKmj=.....p.*"....I6YD
...E4.?. ......3..X}rd=V..|_,..%}..l-.o.hG!.......V.i..V.C..!."....h..
. .1.m.H7...J...FO.. jb.v)..Gn....L....R2...Qv.....o..P....[Je.Y.V....
.Ku.......v(.U8|>.Ht... ..V..T.NL.7.j.C.....J...... ..........;..-.
.)...U...mA.7......W..p-....b.YM..S....Ex......<e<W........;./..
.............WNW\...s..J...............B.[5..H.6.J/...../.g(....B..} F
........Z...O.qE.....o.,.J.1f....X.[7.?.....Jj.D.#. [email protected].._
.... gD."w..C...A.~X..^..r.z9.SC...]..... .&........B@..!....6..Ly.x..
fWc.Qz.[.c7.....<] ...y.....m.....'>2}.a.[....z...I.V.E.n.@...~.
.M.$....O.%..kFH..G5...Z......9.h.).(kzDz..$NeL.n.......,>..7......
.0..6w.........*.h....Q.)...tU.z....`W..?|...MOA}./..~y..w3.....1...{D
%.b.L/H,....d~;.0W D...GsB...#..!............. s.?..y.S....a.Z....
<<< skipped >>>


.... zt..........6'.6I..8..5.(.oA.A<..... E't..oP]EFz.].a...f..q.a.
Zu=.8.lQ..pAj%.B..h.hP......\........E1T.........4X..z9 cqg.....1....8
./.....f.3.~..W?.%A.|9..JL*....8...y.Q.. .?..*7.h$...g......S..w.3..Yj
3...C...N............MJf....i.. QA..6.5y....E".5.p.........cyK}r.he5..
..P.........`Q....".Y =..24...<1.....*.l.,v.Q......]F....A,:.......
.^V...p..\C<......#l\.P4H.....f^..."........z....J..az.i..e.k.ps*2N
J.^D$.....Q..m'.^..[[email protected].=..^K.l...&X .h53G.)...C..(....
.755f.]......q..9BH.........m...#/[email protected]...(......|...s$
[email protected]...



.... ...........]_.....;a.....Mb..\...... .6..um..M.< -..~.....zyT.
.G.... &..SJ...$...'.d..> spk.}......` ...4...-....<.....N..r...
.2.....J.C9p.....9....3gH...*Ch..4?pY6.^..O~....7Z.j...U.......1..... 
.Q..........~........g..7..............h>...o#....{.........A..;.k.
....1E~...\....i$........... ...B...|...6..B. ..X.*:../.....j.....?N..
.N..y.}d,.:.Xkw...9...d..&.....*-T.J_.m.-...$a]...:....O^Z&.`T... [...
.v.....l.... .s)8k.g.^..]..Rx...).a........R.T..P.......08........l.E.
b...%..5..."..q..,:n.@.........;..n.-ag(0....EK<s..E<.....l./W..
....u......(..-~).......,....o.....H.;...!....



.... 9Ti.zf..6.o.....eg 1...rv...Sa...... ..c...3..X5...Lk..X5N.I.9..K
..Y.\..>4Qo ....X..).c....p.JE....h=....aV.Q4</..c.i...Hj..^..0.
-.KQ....R..Rf,......%.....S-4....f.$v..&..B.T.4/[...6.3FI{0(H ..o...-.
.6n7~w..g]gwa..9..........5.._...%M-...U...\.V0.d.....y ..)R2-...C.../
.r..r..e2..2...j..p..u}.. ...m.#...uO_.G..5........(}!*..u..H3FZ...Hb.
....$..h..'...).q\.JH....>...a...h2.gI.M.."]....y.:A.Q\..7E..P.-8.o
`.p.P......#1x}....jvW.P.pl..R.....6~....2...i.f7... ......1...j#.....
.rO<?....5.[... ]6B%!....z....c..O.i...C.?....B2^V.....`L..q#.?..%i
5y{..b..X.Y].M).l...W..Yw.cQ.........q.... }.k./&;.'..o..._...T W1)..T
eU..~................/...,c`nqP.'....?k~u..fO..6......C].t.....Z....Q#
..{.?...2..Y..n..|[email protected]".PuJ.q9.hG...J@..$.{...F..8t.\Q....=-....0q
.....%...1........=V..s..j.O1...J.:..Gr`..H.Vm.0'.....QH.N........{_.s
...j..r......BX.#....l......i.(3B?#..O...k......(..6...........lr.RHc.
p..T.?@!..k...C...^LI....v<.?4h.......pI..=<Y9....9K|..>..#..
3)[email protected]...?..].{...u..!....O.B...~RB~;y......\.U.o..L.
.#.o.d%.g....V.T[K.......DE...8....".Z;.....S...Ky.8r..s........C..5..
...h........N.I.... ..Z...x.|.....I.P....R. ...K......e.2.h.'..O5G..&.
7A?..d7..\...>H....tE....z._...("..Y.*.;....p......&..-o......z....
l`l.5.....SY$.*..[...YX..D....).r...5.$3.%.._......|.Q1..K.4..;......7
|..f.LH.s......Ht..>a..<.S..s.~........G...n\(...C.s.e.X|.......
v....Z..7C['?".....<.Q.H.ta....b..J...V.|....#.I#....%.$....S....(Z
.R.Th.........i.P...... lN......N....Gj...?..f.,.....d8..........F
<<< skipped >>>


.... :.O.i50v...*4.a....|.......<..VU.... 1.......nq.v>8...\...~
....D.....'..G......2..f..Q|.....c..:Z...o.....N.x.|.........P.....^?.
....lZWS.|% ....).9....t.E&.g.J......x.J.....m.gbf.1t.M.;...xV.np..C..
.......%..C93....B.................,N......=S..`O{.q.P.t..VB..........
.m.h......[..2P....N..2.....a.G.t..8!.X..R]..d....R.h@8;.C...R:..../~.
c.S.i..[.8...j...:hA.7....X.3...........DE ...T]7...Y.......2T.>...
.W .FqDnr.....|.*.Ep..m//>.b..,6.....LO..........W...Uq.J...vU.'.%.
.....9xb..........o|.T.A(QHuM.....O...t..}]j......g.....q..-b.....:...
.m.S..N...D.....h|.d..y.T.......2...Aj.... EKc@.|]h..G..^..7_.j|x..L..
..............5.U..2.6.../.i$.....l..w.F.=}L.D01.#.........{...-....n.
....]@.......\^....u.^.(..f.h,.L>......7{.=f......"..~1....X[5..B..
...?a..[z.m.#...$G2.i.....Z.Z ......`;C..!w.....{Dn...S..$W.l&........
.8.e[!..ia.b...,I.Y'.,\i.u.=..v.O..f.C....G...M.....CX.xV.lTc....I:S .
...J...u.....m...P".....w...n....k...K.......kdZ.g..7fX5..F1.....|z...
[.a .7.>...v..\.n.............to.o.^[email protected]..;.U.
?.....M..5........6..o}.r.._.... ...X......fq.3.E..3.p...z..d:.S.;.'..
...5..H.{.{.....<*......|.oU...t.....5.c...9..@.|..S. ...}}r.x..H.~
..V....`...q9..r..}.r.N0.l.^.......:...^.U...../....I...r..3..r.......
P...../'|...T.n)..f.U.M......3..U/y9.D..s..........A....78....i.......
...*\..p.J...A3...87...u,[email protected]..}FH......J?.".]5.}..}(...x..
...n.../k...../_.......<.....(..O.g..........~ .f"y ...`.H>GhR..
U.9}.&z.e..#qF;8F...f..N.M.......^#s....0...H!Pl...S..5..A"L:...O0
<<< skipped >>>

The Trojan connects to the servers at the folowing location(s):

`.rsrc

{(-t}

Portugal

Turkey

??????????ADADAEAFAFAFAFAGAIALAMANAOAOAOARARARASASATATAUAUAWAXAZAZAZAZAZAZBABABABBBDBEBEBEBEBEBEBFBFBFBGBGBGBHBIBIBJBMBNBNBOBOBRBSBTBTBWBWBWBYBYBYBZCACACACACACACCCDCDCDCDCFCFCGCGCGCHCHCHCHCICICICKCLCLCMCMCNCNCNCNCNCNCNCNCNCNCNCNCNCNCNCOCRCSCSCSCSCSCSCUCVCXCYCYCZDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDJDJDJDKDKDMDODZECEEEEEGERERERERERERETETETETETETETETETFIFIFIFJFJFKFMFOFOFRFRFRFRFRGAGBGBGBGBGBGBGBGBGBGBGDGEGEGEGFGHGHGHGHGIGLGLGMGMGMGNGPGQGRGTGUGUGWGYHKHKHKHKHNHRHRHTHTHUHUHUHUIDIDIDIEIEILILILILINININININININININININININININININININININIOIQIQIRIRIRISITITITITITJMJOJPKEKEKEKEKEKGKGKHKIKMKNKPKRKWKYKZKZKZKZLALBLBLCLILKLRLSLSLSLTLTLULULULVLVLYMAMCMDMDMDMDMDMGMGMHMHMKMKMLMLMMMNMOMOMOMPMPMQMRMRMSMTMTMUMVMWMWMXMYMYMZMZNANANANCNENENENENFNGNGNGNGNGNGNINLNLNLNONONONONONPNRNRNUNZNZOMPAPEPEPEPFPFPGPGPHPHPKPKPKPLPLPLPMPNPRPRPSPTPWPYPYQARERORORORORURURURURURURURURURURWRWRWSASBSCSCSDSDSDSESESESESESGSGSGSGSGSGSHSISISKSKSLSMSNSNSOSOSOSRSRSTSVSYSYSZSZTCTDTDTGTGTGTHTHTJTJTJTKTLTMTMTNTOTOTRTRTRTRTRTTTVTVTWTWTWTWTWTZUAUAUAUAUAUAUAUAUAUGUGUMUSUSUSUSUSUSUSUYUZUZUZUZUZVAVAVAVCVEVGVIVNVUVUVUWFWSWSYEYTYUYUYUZAZAZAZAZAZAZAZAZAZAZMZWZWZWZWZW

pipe

.PjFh

6-9'6-9'

$6.:$6.:

*?#1*?#1

>8$4,8$4,

AES for x86, CRYPTOGAMS by 

\$.Sj

SHA1 block transform for x86, CRYPTOGAMS by 

DlSHA512 block transform for x86, CRYPTOGAMS by 

RC4 for x86, CRYPTOGAMS by 

SHA256 block transform for x86, CRYPTOGAMS by 

3\$83|$<

Camellia for x86 by 

AES for Intel AES-NI, CRYPTOGAMS by 

tcPjXh`3

Montgomery Multiplication for x86, CRYPTOGAMS by 

Pj(j%S

Pj@j%S

GHASH for x86, CRYPTOGAMS by 

|$$ |$4)|$

GF(2^m) Multiplication for x86, CRYPTOGAMS by 

FtPWV

FtPU

FtPWW

9|$ }[ |$ 9

Advanced Onion Router v0.3.0.20

2004-2006, Roger Dingledine, Nick Mathewson

This product includes software developed by the OpenSSL Project for use in the OpenSSL Toolkit (http://www.openssl.org/), zlib (http://www.zlib.net/) and libevent (http://www.monkey.org/~provos/libevent/).

[2] Graphical Interface, extensions added to Tor client and AdvOR.dll are distributed under Creative Commons Attribution - NonCommercial - ShareAlike license ( http://creativecommons.org/licenses/by-nc-sa/3.0/ ).

SOFTWARE\Microsoft\Windows\CurrentVersion\Run

l}C.we

%s:%d: %s: Assertion %s failed; aborting.

pos.chunk_pos   pos.pos < INT_MAX

fetch_from_buf_http

%d %d

waiting for keys

%s%s circ (length %d%s%s):

%s(%s)

and DirPort %s:%d

circ->_base.state == CIRCUIT_STATE_BUILDING

CLOCK_JUMPED TIME=%d

CIRCUIT_NOT_ESTABLISHED REASON=%s

key_data

hop->state == CPATH_STATE_AWAITING_KEYS

circuit_all_predicted_ports_handled

router_handles_some_port

port

%s %s

%s %s %s

%s [%s] (%s, %s)

%s [%s] (up %s)

Unable to parse entry nodes: Bad nickname for EntryGuard

0.1.0.10-alpha

0.1.2.16-dev

0.2.0.0-alpha

0.2.0.6-alpha

old_conn->_base.magic == OR_CONNECTION_MAGIC

unknown state [%d]

UNKNOWN_%d

other->_base.magic == OR_CIRCUIT_MAGIC

conn->_base.type == CONN_TYPE_EXIT

[%s][%s] %s_%d - %s

purpose == CIRCUIT_PURPOSE_C_GENERAL || purpose == CIRCUIT_PURPOSE_C_INTRODUCE_ACK_WAIT || purpose == CIRCUIT_PURPOSE_C_REND_JOINED

?circuit_remove_handled_ports

circuit_remove_handled_ports

*port

REACHABILITY_FAILED ORADDRESS=%s:%d

conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT

%s.%s.exit

conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT || conn->_base.state == AP_CONN_STATE_CONTROLLER_WAIT

circ->_base.state == CIRCUIT_STATE_OPEN

ControlPort

If set, Tor will accept connections from the same machine (localhost only) on this port, and allow those connections to control the Tor process using the Tor Control Protocol (described in control-spec.txt).

If this option is set to 1, don't allow any connections to the control port except when the connecting process can read a file that Tor creates in its data directory.

Tor only trusts directories signed with one of these servers' keys. Used to override the standard list of directory authorities.

Force Tor to make all HTTP directory requests through this host:port (or host:80 if port is not set).

A username:password pair to be used with DirProxy.

Force Tor to make all TLS (SSL) connectinos through this host:port (or host:80 if port is not set).

A username:password pair to be used with ORProxy.

If non-zero, when a directory server we contact supports it, we will build a one-hop circuit and make an encrypted connection via its ORPort.

If set to 1, Tor will under no circumstances run as a server, even if ORPort is enabled.

If set, Tor will only create outgoing connections to servers running on the ports listed in FirewallPorts.

FirewallPorts

A list of ports that we can connect to. Only used when FascistFirewall is set.

LongLivedPorts

A list of ports for services that tend to require high-uptime connections.

Addresses we can connect to, as IP/bits:port-port. By default, we assume all addresses are reachable.

SOCKSPort

The port where we listen for SOCKS connections from applications.

Set an entry policy to limit which addresses can connect to the SOCKSPort.

If set, Tor will fail to operate when none of the configured ExitNodes can be used.

If set, Tor will fail to operate when none of the configured EntryNodes can be used.

Address/port ranges for which to accept or reject outgoing connections on behalf of Tor users.

Nickname

Set the server nickname.

How many processes to use at once for public-key crypto.

ORPort

Advertise this port to listen for connections from Tor clients and servers.

Bind to this address to listen for connections from clients and servers, instead of the default 0.0.0.0:ORPort.

DirPort

Serve directory information from this port, and act as a directory cache.

DirPortFrontPage

Serve a static html disclaimer on DirPort.

Bind to this address to listen for connections from clients and servers, instead of the default 0.0.0.0:DirPort.

Set a policy to limit who can connect to the directory port.

Programs added to "Quick Start" menu can be executed with "Force TOR" enabled.

Programs added to "Quick Start" menu can be executed with "Force TOR" enabled and when AdvOR exits it will also close them, or when one of those programs exits, AdvOR will close the rest of them and will exit.

Plugins that can be used by Advanced Onion Router must be placed in %[exename]-plugins\ directory. For more information about writing plugins, see plugins.txt.

How many times will a hidden service operator attempt to connect to a requested rendezvous point before giving up.

FirewallPort

LongLivedPort

HashedControlPassword

__HashedControlSessionPassword

.onion,.exit

BridgePassword

DNSPort

ExitPortStatistics

HiddenServiceKey

HiddenServicePort

NatdPort

RejectPlaintextPorts

www.google.com,www.mit.edu,www.yahoo.com,www.slashdot.org

SocksPort

TransPort

V3AuthUseLegacyKey

127.192.0.0/10

WarnPlaintextPorts

23,109,110,143

HTTPFlags

HTTPAgent

HTTPOS

0.2.2.39

HotkeyRestore

HotkeyNewIdentity

HotkeyIntercept

HotkeyRelease

HotkeyHideAll

HotkeyRestoreAll

LastRotatedOnionKey

The last time at which we changed the medium-term private key used for building circuits.

We've been configured to use (or avoid) nodes in certain contries, and we need GEOIP information to figure out which ones they are.

options && key

EXTERNAL_ADDRESS ADDRESS=%s METHOD=%s %s%s

validate_ports_csv

orport=

%s%s%s%s

%s=%s

Tor %s

Unix domain sockets (ControlSocket) not supported on this OS/with this build.

Failed to bind one of the listener ports.

BAD_LIBEVENT VERSION=%s METHOD=%s BADNESS=%s RECOVERED=NO

--hash-password

Advanced Onion Router version %s.

0.3.0.20

--exec

unknown [%d]

unknown state [%d] on unknown [%s] connection

TOO_MANY_CONNECTIONS CURRENT=%d

%s now %d.

0.0.0.0

127.0.0.1

Chosen Or/DirPort changed

.virtual

.exit

Can't specify ports on VirtualAddressNetwork

%s %s NEVER

%s %s "%s"

REVERSE[%s]

conn->_base.type == CONN_TYPE_AP

ap_conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT

ap_conn->_base.type == CONN_TYPE_AP

circ->_base.purpose == CIRCUIT_PURPOSE_C_GENERAL

circ->_base.timestamp_dirty

%s:%d

consider_plaintext_ports

DANGEROUS_PORT PORT=%d RESULT=%s

.%s.exit

SOCKS_BAD_HOSTNAME HOSTNAME=%s

conn->_base.state == AP_CONN_STATE_NATD_WAIT

edge_conn->_base.type == CONN_TYPE_EXIT

conn->_base.magic == OR_CONNECTION_MAGIC

conn->_base.type == CONN_TYPE_OR

msg_out

has_cert

conn->_base.state == OR_CONN_STATE_TLS_HANDSHAKING

PROXY_HTTPS_WANT_CONNECT_OK

Address type not supported

Command not supported

server doesn't support any of our available authentication methods

CONNECT %s:%d HTTP/1.0

CONNECT %s:%d HTTP/1.1

Host: %s:%d

Proxy-Authorization: Basic %s

connection_read_https_proxy_response

HTTP/1.%u %u

Authorization: NTLM %s

Router descriptors by nickname.

Brief summary of router status by nickname (v2 directory format).

Breakdown of bytes transferred over DirPort.

Router descriptors as retrieved from a DirPort.

v2 networkstatus docs as retrieved from a DirPort.

v3 Networkstatus consensus as retrieved from a DirPort.

control_ports_write_to_file

PORT=%s:%d

%s: %s

decode_hashed_passwords

passwords

515 Authentication failed: %s

551 Invalid quoted string. You need to put the password in double quotes.

Password did not match HashedControlPassword *or* authentication cookie.

Password did not match HashedControlPassword value from configuration

Password did not match HashedControlPassword value from configuration. Maybe you tried a plain text password? If so, the standard requires that you put it in double quotes.

551 Invalid hexadecimal encoding. Maybe you tried a plain text password? If so, the standard requires that you put it in double quotes.

Couldn't decode HashedControlPassword value in configuration.

512-syntax error: mapping '%s' is not of expected form 'foo=bar'.

250-%s=%s

512-syntax error: invalid address '%s'

250-%s

451-resource exhausted: skipping '%s'

/tor/%s

%s%s -- %s

552-Unrecognized key "%s"

552 Unrecognized key "%s"

250 %s=

250-%s=

551 %s

getinfo_items[i].fn

512 Too many arguments to %s

512 Missing argument to %s

552 Bad value hop=%s

552 Unknown stream "%s"

552 Unknown circuit "%s"

551 Circuit doesn't have %d hops.

552 Unknown purpose "%s"

251 %s

512 Unexpected argument "%s" to postdescriptor

554 %s

552 Unknown cache request "%s"

512 Cannot parse port "%s"

552 Unrecognized reason "%s"

250-AUTH METHODS=%s%s%s

250-VERSION Tor=%s

HASHEDPASSWORD

513 No such version %s

250 AUTHCHALLENGE SERVERHASH=%s SERVERNONCE=%s

513 AUTHCHALLENGE only supports SAFECOOKIE authentication

552 Unrecognized feature "%s"

PURPOSE=%s

650 CIRC %lu %s%s%s %s

REASON=%s

REASON=DESTROYED REMOTE_REASON=%s

552 No such router "%s"

%s%s%s:%d

.onion

REASON=UNKNOWN_%d

650 STREAM %I64u %s %lu %s%s%s%s

SOURCE_ADDR=%s:%d

REASON=END REMOTE_REASON=%s

UNKNOWN_%d

len > MAX_VERBOSE_NICKNAME_LEN

%lu %s%s%s PURPOSE=%s

%lu %s %lu %s

OR=%d DIR=%d

%sNCIRCS=%d

650 ORCONN %s %s %s%s%s

650 NEWDESC %s

650 ADDRMAP %s %s NEVER %s

650 ADDRMAP %s %s "%s" %s%sEXPIRES="%s"

The v0 control protocol is not supported by Tor 0.1.2.17 and later; upgrade your controller.

552-Unrecognized configuration key "%s"

552 Unrecognized configuration key "%s"

conn->_base.state == CONTROL_CONN_STATE_OPEN || conn->_base.state == CONTROL_CONN_STATE_NEEDAUTH

data_len>(size_t)cmd_len

552 Unrecognized event "%s"

552 Unrecognized signal code "%s"

510 Unrecognized command "%s"

650 BUILDTIMEOUT_SET %s TOTAL_TIMES=%lu TIMEOUT_MS=%lu XM=%lu ALPHA=%f CUTOFF_QUANTILE=%f TIMEOUT_RATE=%f CLOSE_MS=%lu CLOSE_RATE=%f

650 %s %s

BUG REASON="%s"

650 GUARD ENTRY %s %s

$%s~%s

loading_keys

BOOTSTRAP PROGRESS=%d TAG=%s SUMMARY="%s"

NOTICE %s

WARN %s

BOOTSTRAP PROGRESS=%d TAG=%s SUMMARY="%s" WARNING="%s" REASON=%s COUNT=%d RECOMMENDATION=%s

650 CLIENTS_SEEN %s

Tor 0.2.0.0-alpha-dev (r10070)

conn->_base.purpose == DIR_PURPOSE_FETCH_SERVERDESC || conn->_base.purpose == DIR_PURPOSE_FETCH_EXTRAINFO

http://%s

If-Modified-Since: %s

/tor/rendezvous/%s

%s %s%s HTTP/1.0

Host: %s%s%s

/tor/rendezvous2/%s

/tor/status-vote/current/consensus/%s.z

/tor/status-vote/next/%s.z

/tor/keys/%s

/tor/extra/%s

/tor/server/%s

/tor/status/%s

conn->_base.type == CONN_TYPE_DIR

parse_http_url

parse_http_response

write_http_status_line

HTTP/1.0 %d %s

write_http_response_header_impl

HTTP/1.0 200 OK

Date: %s

Content-Type: %s

Content-Encoding: %s

Expires: %s

X-Your-Address-Is: %s

Not supported.

conn->_base.state == DIR_CONN_STATE_CONNECTING

http_set_address_origin

/tor/keys/

/tor/robots.txt

/tor/keys/all

/tor/keys/authority

/tor/keys/fp/

/tor/keys/sk/

/tor/keys/fp-sk/

connection_dir_download_cert_failed

conn->_base.purpose == DIR_PURPOSE_FETCH_CERTIFICATE

conn->_base.purpose != DIR_PURPOSE_FETCH_EXTRAINFO

or_port || dir_port

CLOCK_SKEW SKEW=%ld SOURCE=DIRSERV:%s:%d

@downloaded-at %s

@source %s

%s%s%s

ACCEPTED_SERVER_DESCRIPTOR DIRAUTH=%s:%d

BAD_SERVER_DESCRIPTOR DIRAUTH=%s:%d REASON="%s"

nickname

0.2.1.30

0.2.2.1-alpha

0.2.2.21-alpha

dirserv_get_nickname_by_digest

published %s

recommended-software %s

router-status %s

dir-signing-key

%sdirectory-signature %s

r %s %s %s%s%s %s %d %d

s%s%s%s%s%s%s%s%s%s%s%s%s%s

w Bandwidth=%d

opt v %s

Measured=%d

tor_memeq(desc->cache_info.signed_descriptor_digest, rs->descriptor_digest, DIGEST_LEN)

0.1.1.16-rc-cvs

0.2.1.31

0.2.2.34

0.2.3.6-alpha

tor_version_parse("0.2.3.6-alpha", &first_good_later_guard_version)>=0

tor_version_parse("0.2.2.34", &first_good_0_2_2_guard_version)>=0

tor_version_parse("0.2.1.31", &first_good_0_2_1_guard_version)>=0

private_key

cert

client-versions %s

server-versions %s

dir-source %s %s %d

fingerprint %s

contact %s

dir-options%s%s%s%s

%sdir-signing-key

directory-signature %s

Key not recognized

@uploaded-at %s

conn->_base.state == DIR_CONN_STATE_SERVER_WRITING

vote-status %s

consensus-methods %s

valid-after %s

fresh-until %s

valid-until %s

voting-delay %d %d

%sknown-flags %s

dir-source %s %s %s %s %d %d

legacy-dir-key %s

private_signing_key

outp   cert->cache_info.signed_descriptor_len < endp

%s%s%s %s %s %s

consensus-digest %s

additional-digest %s %s %s

authority_cert_dup

vote->cert

onion-key

family %s

m %s sha256=%s

1234567890

network-status-version 3%s%s

known-flags %s

dir-source %s%s %s %s %s %d %d

vote-digest %s

consensus-method %d

Missing consensus bandwidth for router %s

vote->supported_methods

bandwidth-weights Wbd=%d Wbe=%d Wbg=%d Wbm=%d Wdb=%d Web=%d Wed=%d Wee=%d Weg=%d Wem=%d Wgb=%d Wgd=%d Wgg=%d Wgm=%d Wmb=%d Wmd=%d Wme=%d Wmg=%d Wmm=%d

Wbd=%d Wbe=%d Wbg=%d Wbm=%d Wdb=%d Web=%d Wed=%d Wee=%d Weg=%d Wem=%d Wgb=%d Wgd=%d Wgg=%d Wgm=%d Wmb=%d Wmd=%d Wme=%d Wmg=%d Wmm=%d

fast_memeq(lowest_id, rs->status.identity_digest,DIGEST_LEN)

fast_memeq(rs_out.identity_digest, vsr->status.identity_digest, DIGEST_LEN)

vsr->status.exitsummary

moria1 orport=9101 no-v2 v3ident=D586D18309DED4CD6D57C18FDB97EFA96D330566 128.31.0.39:9131 9695 DFC3 5FFE B861 329B 9F1A B04C 4639 7020 CE31

tor26 v1 orport=443 v3ident=14C131DFC5C6F93646BE72FA1401C02A8DF2E8B4 86.59.21.38:80 847B 1F85 0344 D787 6491 A548 92F9 0493 4E4E B85D

dizum orport=443 v3ident=E8A9C45EDE6D711294FADF8E7951F4DE6CA56B58 194.109.206.212:80 7EA6 EAD6 FD83 083C 538F 4403 8BBF A077 587D D755

Tonga orport=443 bridge no-v2 82.94.251.203:80 4A0C CD2D DC79 9508 3D73 F5D6 6710 0C8A 5831 F16D

turtles orport=9090 no-v2 v3ident=27B6B5996C426270A5C95488AA5BCEB6BCC86956 76.73.17.194:9030 F397 038A DC51 3361 35E7 B80B D99C A384 4360 292B

gabelmoo orport=443 no-v2 v3ident=ED03BB616EB2F60BEC80151114BB25CEF515B226 212.112.245.170:80 F204 4413 DAC2 E02E 3D6B CF47 35A1 9BCA 1DE9 7281

dannenberg orport=443 no-v2 v3ident=585769C78764D58426B8B52B6651A5A71137189A 193.23.244.244:80 7BE6 83E6 5D48 1413 21C5 ED92 F075 C553 64AC 7123

urras orport=80 no-v2 v3ident=80550987E1D626E3EBA5E5E75A458DE0626D088C 208.83.223.34:443 0AD3 FA88 4D18 F89E EA2D 89C0 1937 9E0E 7FD9 4417

maatuska orport=80 no-v2 v3ident=49015F787433103580E3B66A1707A00E60F2D15B 213.115.239.118:443 BD6A 8292 55CB 08E6 6FBE 7D37 4836 3586 E46B 3810

%s\wininet.dll

HttpOpenRequestA

HttpSendRequestA

InternetOpenUrlA

https://bridges.torproject.org

bridges.torproject.org

HTTPS

dlg_bypassbl.c

iplist.dat

%s.&log

%s=%d,"%s" %s

%s (PID: %d)

PID: %u

=%d,"%s"

%s.onion

%s.onion ( %s )

ShowOpenPorts

%s [exit(%s%s): %d.%d.%d.%d (%s)]

%s [exit(%s%s): %d.%d.%d.%d]%s

%s - %s

%s - %s exit

%s [exit(%s)]%s

%s-%s.lng

%u,%u,%u,%u,%u,%u,%u,%u

%s %s by Albu Cristian, 2009-2012

UnregisterPluginKey

GetProcessChainKey

GetChainKeyName

RegisterPluginKey

%s reject *:*

[%s%s] %d.%d.%d.%d - $

[%s%s] %d.%d.%d.%d (%s)

%d.%d.%d.%d:%d

-> %s

[Internal][%s] %s_%d - %s

[Exit][%s] %s_%d - %s

[%s] %s_%d - %s

[%s] Circuit_%d - %s

; [%s%s] %d.%d.%d.%d (

dlg_proxy_http.c

%s,%s

[X] %s

[E] %s

CtrlId: %u, reference.left: %ld, reference.top: %ld, reference.right: %ld, reference.bottom: %ld

NAMESERVER_STATUS NS=%s STATUS=DOWN ERR=%s

eventdns: %s

NAMESERVER_STATUS NS=%s STATUS=UP

.invalid

.test

!resolve->result.a.addr

!resolve->result.hostname

conn->_base.state == EXIT_CONN_STATE_RESOLVING

%s.tmp

%s*.*

%s-%s-%s

%s-%s

Invalid password.

cached-certs

cached-descriptors.new

keys-secret_onion_key

keys-secret_onion_key.old

keys-legacy_signing_key

keys-authority_signing_key

keys-legacy_certificate

keys-authority_certificate

keys-secret_id_key

%s--*.*

%s-%s-private_key

%s-%s-client_keys

%s-%s-hostname

-private_key

%s.bak

ntdll.dll

kernel32.dll

\??\%s

NtDeleteFile(): the file %s was deleted successfully

ForceDelete(): could not delete the file %s

ForceDelete(): the file %s was deleted successfully

%s\*.*

ForceDelete(): the directory %s was deleted successfully

%s\%s

Deleting %s

ForceDelete(): could not delete the directory %s

complete=%u,timeout=%u,running=%u

,min=%u,d1=%u,d2=%u,q1=%u,d3=%u,d4=%u,md=%u,d6=%u,d7=%u,q3=%u,d8=%u,d9=%u,max=%u

%s=%u

dirreq-stats-end %s (%d s)

dirreq-v3-ips %s

dirreq-v2-ips %s

dirreq-v3-reqs %s

dirreq-v2-reqs %s

dirreq-v3-resp ok=%u,not-enough-sigs=%u,unavailable=%u,not-found=%u,not-modified=%u,busy=%u

dirreq-v2-resp ok=%u,unavailable=%u,not-found=%u,not-modified=%u,busy=%u

dirreq-v3-direct-dl %s

dirreq-v2-direct-dl %s

dirreq-v3-tunneled-dl %s

dirreq-v2-tunneled-dl %s

BTimeStarted="%s" CountrySummary=%s

bridge-stats-end %s (%ld s)

bridge-ips %s

entry-stats-end %s (%u s)

entry-ips %s

\Macromedia\Flash Player\macromedia.com\support\flashplayer\sys

Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders

[HKEY_CURRENT_USER\Software\Microsoft\MediaPlayer\Player\Settings]

undo.reg

{XX-X-X-X-XXX}

%s%s"

%s\Application Data

%s\AppData\LocalLow\Microsoft\Silverlight\is\*.*

%s\AppData\LocalLow\Microsoft\Silverlight\is\%s

%s\Microsoft\Silverlight\is\*.*

%s\Microsoft\Silverlight\is\%s

%s%s\*.*

%s%s\%s\*.*

%s%s\%s\%s

%s%s\%s

settings.sol

macromedia.com

%s%i%s

inetcpl.cpl

wininet.dll

FindFirstUrlCacheEntryA

FindNextUrlCacheEntryA

FindCloseUrlCache

DeleteUrlCacheEntry

index.dat

%s : %s [PID: %u]

%sInternet Explorer [inetcpl.cpl]

%s\Microsoft\Internet Explorer\DOMStore\*.*

%s\Microsoft\Internet Explorer\DOMStore\%s

%s\Microsoft\Windows\Cookies\*.*

%s\Microsoft\Windows\Cookies\%s

%s\Cookies\*.*

%s\Cookies\%s

%s\AppData\LocalLow\Microsoft\Internet Explorer\DOMStore\*.*

%s\AppData\LocalLow\Microsoft\Internet Explorer\DOMStore\%s

%sInternet Explorer

%sInternet Explorer [wininet.dll]

opera.dll

operaprefs_default.ini

profile\cookies4.dat

profile\icons\cache\cookies4.dat

%sOpera [Multi User]

%s\Opera\*.*

%s\Opera\%s\icons\cache\cookies4.dat

%s\Opera\%s\cookies4.dat

%s\Opera\%s\profile\cookies4.dat

%s\Opera\%s\pstorage

%sOpera [Portable]

%sOpera [opera.dll]

xul.dll

%s\Mozilla\Firefox\Profiles\*.*

%s\Mozilla\Firefox\Profiles\%s\cookies.sqlite

%s\Mozilla\Firefox\Profiles\%s\sessionstore.js

%sFirefox

%s%i.

%sFirefox [xul.dll]

%s\Google\Chrome\User Data\Default\Cookies

%s\Google\Chrome\User Data\Default\Extension Cookies

%s\Google\Chrome\User Data\Default\Local Storage\*.*

%s\Google\Chrome\User Data\Default\Local Storage\%s

%sChrome

CFHTTPCookieStorageDeleteAllCookies

_CFHTTPCookieStorageGetDefault

%s\Apple Computer\Safari\LocalStorage\*.*

%s\Apple Computer\Safari\LocalStorage\%s

%s\Apple Computer\Safari\Cookies\Cookies.plist

%sSafari

%sSafari [CFNetwork.dll]

chrome.dll

cfnetwork.dll

CFNetwork.dll

Real port(s)

Virtual port(s)

The process with PID %d was released successfully

There was an error while trying to release the process with PID %d.

AdvOR.dll was not unloaded.

Added to favorites: %s

Added to banlist: %s

--exec [file]

Bypass ISP filtering

HTTP headers

Firewall restrictions ([reject] range|*:port|*), each rule on a new line:

Start with Windows

Control port:

Require authentication with password hash(es):

Disallow non TCP sockets

Proxy port:

Banned ports (port1,port2,...):

Ports for services that have long-running connections:

Do not use the public key step for the entry node when creating circuits (faster)

Banned routers ([X] nicknames or hashes), each router on a new line:

Favorite routers ([E|X] nicknames or hashes), each router on a new line:

Port:

Nickname:

Accept only these addresses (range:port):

Banned IPs / ports (range:port)

Also, adjust reported local time to a random router's local time

Real port(s):

Virtual port(s):

Save to %s

Circuit length: %d routers

Cleaned freelist for %d-byte chunks: original length %d, kept %d, dropped %d.

%I64u bytes in %d %d-byte chunks [%I64u misses; %I64u frees; %I64u hits]

Encountered eof on fd %d

Read %ld bytes. %d on inbuf.

flushed %d bytes, %d ready to flush, %d remain.

headerlen %d, bodylen %d.

headerlen %d larger than %d. Failing.

bodylen %d larger than %d. Failing.

Got a contentlen of %d.

bodylen reduced to %d.

socks5: command %d not recognized. Rejecting.

socks5 IP takes %d bytes, which doesn't fit in %d. Rejecting.

Your application (using socks5 to port %d) is giving Tor only an IP address. Applications that do DNS resolves themselves may leak information. Consider using Socks4A (e.g. via privoxy or socat) instead. For more information, please see http://wiki.torproject.org/noreply/TheOnionRouter/TorFAQ#SOCKSAndDNS.%s

socks5 hostname is %d bytes, which doesn't fit in %d. Rejecting.

Your application (using socks5 to port %d) gave Tor a malformed hostname: %s. Rejecting the connection.

Your application (using socks5 to port %d) gave Tor a hostname, which means Tor will do the DNS resolve for you. This is good.

socks5: unsupported address type %d. Rejecting.

socks4: command %d not recognized. Rejecting.

socks4: Port or DestIP is zero. Rejecting.

socks4: destip not in form 0.0.0.x.

socks4 addr (%d bytes) too long. Rejecting.

socks4: successfully read destip (%s)

Your application (using socks4 to port %d) is giving Tor only an IP address. Applications that do DNS resolves themselves may leak information. Consider using Socks4A (e.g. via privoxy or socat) instead. For more information, please see http://wiki.torproject.org/noreply/TheOnionRouter/TorFAQ#SOCKSAndDNS.%s

Your application (using socks4a to port %d) gave Tor a hostname, which means Tor will do the DNS resolve for you. This is good.

Your application (using socks4 to port %d) gave Tor a malformed hostname: %s. Rejecting the connection.

Attempt to bypass proxy settings with address %s:%u .

%s: Attempt to bypass proxy settings with address %s:%u .

Not a proxy request: %s

Socks version %d not recognized. (Tor is not an http proxy.) - %s

Chosen circID %u.

First hop: finished sending %s cell to '%s'

Looking for firsthop '%s:%u'

Next router is %s: %s

or_conn to %s/%s, status=%d

Now checking whether ORPort %s:%d%s %s reachable... (this may take up to %d minutes -- look for log messages indicating success)

Your system clock just jumped %d seconds %s; assuming established circuits no longer work.

Wrong length %d on extend cell. Closing circuit.

Client asked me to extend to zero destination port or addr.

Next router (%s:%d): %s

n_conn is %s:%u

Finished building %scircuit hop:

Marking stream %d for close because of truncate.

Chosen route length %d (%d/%d routers suitable).

Not enough acceptable routers (%d). Discarding this circuit.

Not enough routers: cutting routelen from %d to %d.

Choosing exit node; %d connections are pending

Skipping node %s -- it's me.

Skipping node %s (index %d) -- invalid router.

Skipping node %s (index %d) -- it rejects all.

%s is supported. n_supported[%d] now %d.

%s (index %d) would reject this stream.

%s is new best supported option so far.

Found %d servers that might support %d/%d pending connections.

We couldn't find any live%s%s routers; falling back to list of all routers.

Try %d: '%s' is a possibility.

Chose exit server '%s'

Unhandled purpose %d

Requested exit node '%s' is in ExcludeNodes, or ExcludeExitNodes, using anyway.

Using requested exit node '%s'

Couldn't extend circuit to new point '%s'.

Contemplating whether router %d (%s) is a new option.

Nope, the directory says %d is not running.

Nope, the directory says %d is not valid.

I like %d. num_acceptable_routers now %d.

Path is complete: %d steps long

Path is %d long; we want %d

Failed to find node for hop %d of our path. Discarding this circuit.

Chose router %s for hop %d (exit is %s)

Entry guard %s (%s) is %s: marking as unusable.

Entry guard %s (%s) is no longer unusable: marking as ok.

Chose '%s' as new entry guard.

Entry guard '%s' (%s) %s. (Version=%s.) Replacing it.

Entry guard '%s' (%s) has been down or unlisted since %s local time; removing.

Summary: Entry '%s' is %s, %s%s%s, and %s.

(%d/%d entry guards are usable/new)

Entry guard '%s' (%s) is now reachable again. Good.

Connection to never-contacted entry guard '%s' (%s) failed. Removing from the list. %d/%d entry guards usable/new.

Unable to connect to entry guard '%s' (%s). Marking as unreachable.

Failed to connect to unreachable entry guard '%s' (%s). It has been unreachable since %s.

Connected to new entry guard '%s' (%s). Marking earlier entry guards up. %d/%d entry guards usable/new.

Adding configured EntryNodes '%s'.

EntryGuardAddedBy line %s does not begin with hex digest

Unexpected key %s

Can't read time %s in EntryGuardAddedBy

ask_bridge_directly=%d (%d, %d, %d)

Bridge at '%s:%d' isn't reachable by our firewall policy. %s.

Fetching bridge info '%s' from bridge authority.

new bridge descriptor '%s' (%s)

found one: %s

any_known %d, any_running %d

or_conn to %s, %d pending circs

Unknown circuit state %d

Conn %d has %s circuit: circID %d (other side %d), state %d (%s), born %d:

Hunting for a circ to cannibalize: purpose %d, uptime %d, capacity %d, internal %d

Duplicate call to circuit_mark_for_close at %s:%d (first at %s:%d)

Specified 'at-origin' non-reason for ending circuit, but circuit was not at origin. (called %s:%d, purpose=%d)

Reason %d out of range at %s:%d

Failed intro circ %s to %s (awaiting ack). Removing from descriptor.

Unexpected state %d

Considering %sopen purp %d to %s (circid %d).(clean).

Considering %sopen purp %d to %s (circid %d). %d secs since dirty.

Abandoning circ %s:%d:%d (state %d:%s, purpose %d)

Abandoning circ %d (state %d:%s, purpose %d)

Port %d is already being handled; removing.

Port %d is not handled.

Have %d clean circs (%d internal), need another exit circ.

Have %d clean circs (%d internal), need another internal circ for my hidden service.

Have %d clean circs (%d uptime-internal, %d internal), need another hidserv circ.

Closing n_circ_id %d (dirty %d secs ago, purp %d)

Closing circuit that has been unused for %d seconds.

Our testing circuit (to see if your ORPort is reachable) has failed. I'll try again later.

Our circuit failed to get a response from the first hop (%s:%d). I'm going to try to rotate to a better connection.

Couldn't connect to Alice's chosen rend point %s (%s hop failed).

Cannibalizing circ '%s' for purpose %d

unexpected purpose %d when cannibalizing a circ.

%d failures so far, not trying.

n_circuit_failures now %d.

No Tor server allows exit to %s:%d. Rejecting.

Requested exit point '%s' would refuse request. %s.

No intro points for '%s': refetching service descriptor.

Chose '%s' as intro point for '%s'.

considering %d, %s

Broken address %s on tunnel conn. Closing.

Requested exit point '%s' is not known. %s.

No safe circuit (purpose %d) ready for edge connection; delaying.

attaching new conn to circ. n_circ_id %d.

Registering new tracked exit host %s.

Tried for %d seconds to get a connection to %s:%d. Giving up.

Attaching apconn to circ %d (stream %d sec old).

rend joined circ %d already here. attaching. (stream %d sec old)

pending-join circ %d already here, with intro ack. Stalling. (stream %d sec old)

Intro circ %d present and awaiting ack (rend %d). Stalling. (stream %d sec old)

ready rend circ %d already here (no intro-ack yet on intro %d). (stream %d sec old)

found open intro circ %d (rend %d); sending introduction. (stream %d sec old)

Intro (%d) and rend (%d) circs are not both ready. Stalling conn. (%d sec old)

At end of second: %d creates (%d ms), %d createds (%d ms), %d relays (%d ms), %d destroys (%d ms)

Cell of unknown type (%d) received. Dropping.

At end of second: %d versions (%d ms), %d cert (%d ms)

Variable-length cell of unknown type (%d) received.

Received create cell (type %d) from %s:%d, but we're a client. Sending back a destroy.

Received create cell with unexpected circ_id %d. Closing.

Received CREATE cell (circID %d) for known circ. Dropping (age %d).

Details: nickname "%s", platform %s.

Failed to generate key material. Closing.

(circID %d) unknown circ (probably got a destroy earlier). Dropping.

unknown circuit %d on connection from %s:%d. Dropping.

Received an inbound RELAY_EARLY cell on circuit %d from %s:%d. Closing circuit.

Received too many RELAY_EARLY cells on circ %d from %s:%d. Closing circuit.

circuit_receive_relay_cell (%s) failed. Closing.

Received for circID %d.

Received a VERSIONS cell on a connection with its version already set to %d; dropping

Negotiated version %d with %s:%d; sending NETINFO.

Received a NETINFO cell on %s connection; dropping.

Received NETINFO cell with skewed time from server at %s:%d. It seems that our clock is %s by %s, or that theirs is %s. Tor requires an accurate clock to work: please check your time and date settings.

Got good NETINFO cell from %s:%d; OR connection is now open, using protocol version %d

Closing old %s on %s:%d

Closing partially-constructed listener %s on %s:%d

Error loading rendezvous service keys

Error initializing keys; exiting

Choosing default nickname '%s'

DirPortFrontPage file '%s' not found. Continuing anyway.

The configuration option '%s' is deprecated; use '%s' instead.

Commandline: parsed keyword '%s', value '%s'

The abbreviation '%s' is deprecated. Please use '%s' instead

Skipping obsolete configuration option '%s'

Found unrecognized option '%s'; saving it.

Linelist option '%s' has no value. Skipping.

Unknown option '%s'. Failing.

You asked me for the value of an obsolete config option '%s'.

Can't return context-sensitive '%s' on its own

Unknown type %d for known key '%s'

Failed to assign default: %s

Guessed local host name as '%s'

Could not resolve local Address '%s'. Failing.

Could not resolve guessed local hostname '%s'. Trying something else.

Learned IP address '%s' for local interface. Using that.

Guessed local hostname '%s' resolves to a private IP address (%s). Trying something else.

Interface IP address '%s' is a private address too. Ignoring.

Address '%s' resolves to private IP address '%s'. Tor servers that use the default DirServers must have public IP addresses.

Address '%s' resolves to private IP address '%s'. Please set the Address config option to be the IP address you want to use.

Resolved Address to '%s'.

Your IP address seems to have changed to %s. Updating.

Config_get_assigned_option() generated something we couldn't config_assign(): %s

Internal error writing option value %s

You specified a public address '%s' for a %s. Other people on the Internet might find your computer and use it as an open %s. Please don't allow this unless you have a good reason.

SocksPort, TransPort, NatdPort, DNSPort, and ORPort are all undefined, and there aren't any hidden services configured. Tor will still run, but probably won't do anything.

Converting FascistFirewall and FirewallPorts config options to new format: "ReachableAddresses %s"

RendPostPeriod option is too short; raising to %d seconds.

RendPostPeriod is too large; clipping to %ds.

CircuitBuildTimeout option is too short; raising to %d seconds.

MaxCircuitDirtiness option is too short; raising to %d seconds.

You have a ControlListenAddress set to accept unauthenticated connections from a non-local address. This means that programs not running on your computer can reconfigure your Tor, without even having to guess a password. That's so bad that I'm closing your ControlPort for you. If you need to control your Tor remotely, try enabling authentication and using a tool like stunnel or ssh to encrypt remote access.

You have a ControlListenAddress set to accept connections from a non-local address. This means that programs not running on your computer can reconfigure your Tor. That's pretty bad, since the controller protocol isn't encrypted! Maybe you should just listen on 127.0.0.1 and use a tool like stunnel or ssh to encrypt remote connections to your control port.

ControlPort is open, but no authentication method has been configured. This means that any program on your computer can reconfigure your Tor. That's bad! You should upgrade your Tor controller as soon as possible.

Opening config file "%s"

Configuration file "%s" not present, using reasonable defaults.

Unable to open configuration file "%s".

Unparseable bandwidth history state: %s

Skipping invalid argument '%s' in MapAddress

MapAddress '%s' has too few arguments. Ignoring.

Error parsing Bridge address '%s'

Missing port in Bridge address '%s'

Key digest for Bridge is wrong length.

Unable to decode Bridge key digest.

Bridge at %s:%d (%s)

no key listed

Invalid orport '%s' on DirServer line.

Bad v3 identity digest '%s' on DirServer line

Unrecognized flag '%s' on DirServer line

Error parsing DirServer address '%s'

Missing port in DirServer address '%s'

Key digest for DirServer is wrong length %d.

Unable to decode DirServer key digest.

Trusted %d dirserver at %s:%d (%s)

Config file "%s" is not a file? Failing.

Renaming old configuration file to "%s"

Couldn't rename configuration file "%s" to "%s": %s

Unknown unit '%s'.

Interval '%s' is too long

We were compiled with headers from version %s of Libevent, but we're using a Libevent library that says it's version %s.

This will almost certainly make Tor crash.

It's a little hard to tell, but you seem to have Libevent 1.4.0-beta header files, whereas you have linked against Libevent %s. This will probably make Tor crash.

It's a little hard to tell, but you seem to have Libevent header file from 1.3e or earlier, whereas you have linked against Libevent %s. This will probably make Tor crash.

Initialized libevent version %s using method %s. Good.

Libevent version %s often crashes when running a Tor server with %s. Please use the latest version of libevent (1.3b or later)

There are serious bugs in using %s with libevent %s. Please use the latest version of libevent.

There are minor bugs in using %s with libevent %s. You may want to use the latest version of libevent.

libevent %s can be very slow with %s. When running a server, please use the latest version of libevent.

Obsolete file %s hasn't been modified since %s. Removing it.

You have requested constrained socket buffers while also serving directory entries via DirPort. It is strongly suggested that you disable serving directory requests when system TCP buffer resources are scarce.

ORPort must be defined if ORListenAddress is defined.

DirPort must be defined if DirListenAddress is defined.

DNSPort must be defined if DNSListenAddress is defined.

ControlPort must be defined if ControlListenAddress is defined.

TransPort must be defined if TransListenAddress is defined.

NatdPort must be defined if NatdListenAddress is defined.

TransPort and TransListenAddress are disabled in this build.

IPs or countries are not yet supported in EntryNodes.

Running as authoritative directory, but no DirPort set.

Running as authoritative directory, but no ORPort set.

HttpProxy failed to parse or resolve. Please fix.

HttpProxyAuthenticator is too long (>= 512 chars).

HttpsProxy failed to parse or resolve. Please fix.

HttpsProxyAuthenticator is too long (>= 512 chars).

Bad HashedControlPassword: wrong length or bad encoding

Bad HashedControlSessionPassword: wrong length or bad encoding

ConstrainedSockSize is invalid. Must be a value between %d and %d in 1024 byte increments.

Int keyword '%s %s' is malformed or out of bounds.

Interval '%s %s' is malformed or out of bounds.

Value '%s %s' is malformed or out of bounds.

Boolean '%s %s' expects 0 or 1.

Invalid time '%s' for keyword '%s'

Invalid exit list '%s' for option '%s'

Port '%s' out of range in %s

You may not provide a value for virtual option '%s'

Nickname '%s' is wrong length or contains illegal characters.

BandwidthRate is set to %d bytes/second. For servers, it must be at least %d.

MaxAdvertisedBandwidth is set to %d bytes/second. For servers, it must be at least %d.

RelayBandwidthRate is set to %d bytes/second. For servers, it must be at least %d.

Invalid nickname '%s' in %s line

Failed to parse/validate config: %s

unknown connection type %d

unknown connection state %d (type %d)

Error removing read event for %d

Error removing write event for %d

Freeing linked %s connection [%s] with %d bytes on inbuf, %d on outbuf.

Could not unlink %s: %s

closing fd %d.

(Harmless.) Edge connection (marked at %s:%d) hasn't sent end yet?

Closing stream (marked at %s:%d) without sending back a socks reply.

Closing stream (marked at %s:%d) without having set end_reason.

Closing stream (marked at %s:%d) without having replied to DNS request.

fd %d, type %s, state %s, %d bytes on outbuf.

Duplicate call to connection_mark_for_close at %s:%d (first at %s:%d)

Giving up on marked_for_close conn that's been flushing for 15s (fd %d, type %s, state %s).

Error parsing/resolving ListenAddress %s

Unix domain sockets not supported, yet we tried to create one.

Failing because we have %d connections already. Please raise your ulimit -n.%s

Opening %s on %s:%d

Could not bind to %s:%u: %s%s

Could not listen on %s:%u: %s

Opening %s on %s

Socket creation failed: %s.

Bind to %s failed: %s.

Could not listen on %s: %s

Got unexpected address family %d.

%s listening on port %u.

Length of address not as expected: %d vs %d

Address for new connection has address/port equal to zero.

A listener connection returned a socket with a mismatched family. %s for addr_family %d gave us a socket with address family %d. Dropping.

accept() failed: %s. Closing listener.

Connection accepted on socket %d (child of fd %d).

getsockname() for new connection failed: %s

Denying socks connection from untrusted address %s.

Denying dir connection from address %s.

Rejecting request for banned address %s:%u .

Connection request for %s:%u .

Resolve request for %s [:%u] .

Resolve request for %s .

Error creating network socket: %s

Outbound bind address '%s' didn't parse. Ignoring.

Error binding network socket: %s

Connecting to %s:%u.

connect() to %s:%u failed: %s

Connection to %s:%u %s (sock %d).

Closing no-longer-configured %s on %s:%d

Already have %s on %s:%d

Value out of range. num_read=%lu, num_written=%lu, connection type=%s, state=%s

waking up conn (fd %d) for read

waking up conn (fd %d) for write

%d: starting, inbuf_datalen %ld (%d pending in tls object). at_most %ld.

TLS connection closed %son read. Closing. (Nickname %s, address %s)

tls error [%s]. breaking (nickname %s, address %s).

After TLS read of %d: %ld read, %ld written

Moved %d bytes on an internal link!

getsockopt() syscall failed?! Please report to tor-ops.

in-progress connect failed. Removing. (%s)

tls error [%s]. breaking connection.

After TLS write of %d: %ld read, %ld written

write_to_buf failed. Closing circuit (fd %d).

write_to_buf failed. Closing connection (fd %d).

unhandled error on write for conn (type %d, fd %d); removing

getsockname() to check for address change failed: %s

Our IP address has changed. Rotating keys...

setsockopt() to constrain send buffer to %d bytes failed: %s

setsockopt() to constrain recv buffer to %d bytes failed: %s

got unexpected conn type %d.

In buffers for %d connections: %I64u used/%I64u allocated

For %d %s connections: %I64u used/%I64u allocated

stream (marked at %s:%d) sending two socks replies?

conn (fd %d) reached eof. Closing.

data from edge while in '%s' state. Leaving it on buffer.

Got unexpected state %d. Closing.

CircID %d: At an edge. Marking connection for close.

(Harmless.) Calling connection_edge_end (reason %d) on an already ended stream?

called on conn that's already marked for close at %s:%d.

Sending end on conn (fd %d).

No circ to send end on conn (fd %d).

Called in unexpected state %d.

Exit connection to %s:%u (%s) established.

Tried for %d seconds to get a connection to %s:%d. Giving up. (%s)

Conn is waiting (address %s), but lost its circ.

Rend stream is %d seconds late. Giving up on address '%s.onion'.

We tried for %d seconds to connect to '%s' using exit '%s'. Retrying on a new circuit.

Closing onehop stream to '%s/%s' because the OR conn just failed.

Giving up on enclave exit '%s' for destination %s.

Clearing TrackHostExists mappings for exit '%s'

Addressmap: rewriting %s to %s

Loop detected: we've rewritten %s 16 times! Using it as-is.

Rewrote reverse lookup %s -> %s

Temporary addressmap ('%s' to '%s') not performed, since it's already mapped to '%s'

Addressmap: (re)mapped '%s' to '%s'

Address %s now has %d resolve failures.

%d addrs available

Called with unsupported address type (%d)

Internal confusion: I thought that '%s' was mapped to by '%s', but '%s' really maps to '%s'. This is a harmless bug.

Registering map from %s to %s

Map from %s to %s okay.

Application request to port %d: this port is commonly used for unencrypted protocols. Please make sure you don't send anything you would mind the rest of the Internet reading!%s

Port %d listed in RejectPlaintextPorts. Closing.

Client asked for %s:%d

Automapping %s to %s

Missing mapping for virtual address '%s'. Refusing.

Invalid hostname %s; rejecting

Malformed exit address '%s.exit'. Refusing.

Unrecognized server in exit address '%s.exit'. Refusing.

Destination '%s' seems to be an invalid hostname. Failing.

Application asked to connect to port 0. Refusing.

Redirecting address %s to exit at enclave router %s

Attachstream to a circuit is not supported for .onion addresses currently. Failing.

Got a hidden service request for ID '%s'

Invalid service name '%s'

Unknown descriptor %s. Fetching.

Stale descriptor %s. Refetching.

getsockopt() failed: %s

getsockname() to determine transocks destination failed: %s

getsockname() gave an unexpected address family (%d)

Natd handshake was ill-formed; closing. The client said: %s

Natd handshake failed; port %s is ill-formed or out of range.

Sending relay cell to begin stream %d.

Address/port sent, ap socket %d, n_circ_id %d

Rejecting ill-formed reverse lookup of %s

Couldn't generate reverse lookup hostname of %s

Address sent for resolve, ap socket %d, n_circ_id %d

Making internal %s tunnel to %s:%d ...

Unable to parse addr:port in relay begin cell. Closing.

Missing port in relay begin cell. Closing.

Got an unexpected command %d

Didn't find rendezvous service (port %d)

Finished assigning addr/port

%s:%d failed exit policy. Closing.

Didn't find connection '%s' on identity map when trying to remove it.

Your https proxy sent back an oversized response. Closing.

https proxy response not all here yet. Waiting.

Unparseable headers from proxy (connecting to '%s'). Closing.

HTTPS connect to '%s' successful! (200 %s) Starting TLS.

The https proxy sent back an unexpected status code %d (%s). Closing.

Called connection_or_finished_flushing() in unexpected state %d.

OR connect() to router at %s:%u finished.

Encoding https authenticator failed

Marking OR conn to %s:%d as too old for new circuits (fd %d, %d secs old).

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). It is not canonical, and we have another connection to that OR that is.

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). We have a better canonical one (fd %d; %d secs old).

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). We have a better one (fd %d; %d secs old).

starting TLS handshake on fd %d

Tried connecting to router at %s:%d, but it didn't send a cert! Closing.

Got incoming connection with no certificate. That's ok.

Tried connecting to router at %s:%d: It has a cert but it's invalid. Closing.

Incoming connection gave us an invalid cert chain; ignoring.

The certificate seems to be valid on %s connection with %s:%d

Connected to router %s at %s:%d without knowing its key. Hoping for the best.

Tried connecting to router at %s:%d, but identity key was not as expected: wanted %s but got %s.

tls handshake with %s done. verifying.

%d: starting, inbuf_datalen %d (%d pending in tls object).

Sending destroy (circID %d).

Controller gave us config lines that didn't validate: %s

Controller gave us config file that didn't validate: %s

Got authentication cookie with wrong length (%d)

Couldn't decode HashedControlPassword: invalid base16

Bad password or authentication cookie on controller.

Authenticated control connection (%d)

Unable to allocate address for '%s' in MapAddress msg

Skipping MapAddress '%s': wrong number of items.

getinfo '%s': %s

Asked for stream in unknown state %d

Controller used obsolete addr-mappings/ GETINFO key; use address-mappings/ instead.

%s is deprecated; it no longer gives useful information

Skipping unknown option %s

Unrecognized status code %d

Unrecognized status type %d

Unrecognized status severity %d

Error writing authentication cookie to %s.

Bootstrapped %d%%: %s.

Problem bootstrapping. Stuck at %d%%: %s. (%s; %s; count %d; recommendation %s)

Loading authority key certs

...and it left a circuit queued; abandoning circ.

decoding onionskin failed. (Old key or bad software.) Closing.

CPU worker exiting because Tor process closed connection (either rotated keys or died).

CPU worker exiting because of error on connection to Tor process. (Error on %d was %s)

Couldn't construct socketpair for cpuworker: %s

Called with unknown purpose %d

authority cert fetch

Uploading an extrainfo too (length %d)

Publishing server descriptor to directory authorities of type '%s', but no authorities of that type listed!

Unexpected purpose %d

No router found for %s; falling back to dirserver list.

While fetching directory info, no running dirservers known. Will try again later. (purpose %d)

Not sending anonymized request to directory '%s'; we don't have its router descriptor.

Giving up on directory server at '%s'; retrying

Giving up downloading detached signatures from '%s'

Giving up downloading votes from '%s'

anonymized %d, use_begindir %d. Initiating %s

Encoding HTTP authenticator failed

Downloading consensus from %s using %s

Squid does not like URLs longer than 4095 bytes, and this one is %d bytes long: %s%s

Skipping over 'http[s]://hostname' string

Ignoring unrecognized or internal IP %s

Failed to parse header %s

Unrecognized content encoding: %s. Trying to deal.

'fetch' response too large (server '%s:%d'). Closing.

Unparseable headers (server '%s:%d'). Closing.

Received response from directory server '%s:%d': %d %s

Received directory with skewed time (server '%s:%d'): It seems that our clock is %s by %s, or that theirs is %s. Tor requires an accurate clock to work: please check your time, timezone, and date settings.

Received http status code %d (%s) from server '%s:%d'. I'll try again soon.

HTTP body from server '%s:%d' was labeled %s, but it seems to be %s.%s

Unable to decompress HTTP body (server '%s:%d').

Received networkstatus objects (size %d) from server '%s:%d'

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status/%s". I'll try again soon.

Received http status code %d (%s) from server '%s:%d' while fetching consensus directory.

Received consensus directory (size %d) from server '%s:%d'

Unable to load consensus directory downloaded from server '%s:%d'. I'll try again soon.

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/keys/%s".

Received authority certificates (size %d) from server '%s:%d'

Unable to parse fetched certificates

Successfully loaded certificates from fetch.

Got votes (size %d) from server %s:%d

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status-vote/next/%s.z".

Error adding retrieved vote: %s

Added vote(s) successfully [msg: %s]

Got detached signatures (size %d) from server %s:%d

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status-vote/consensus-signatures.z".

Problem adding detached signatures from %s:%d: %s

Received %s (size %d) from server '%s:%d'

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/server/%s". I'll try again soon.

Received %d/%d %s requested from %s:%d

Authority '%s' declined our descriptor (not new)

http status 400 (%s) response from dirserver '%s:%d'. Please correct.

HTTP status %d (%s) reason unexpected while uploading descriptor to server '%s:%d').

Uploaded a vote to dirserver %s:%d

http status 400 (%s) response after uploading vote to dirserver '%s:%d'. Please correct.

http status %d (%s) reason unexpected while uploading vote to server '%s:%d').

Uploaded signature(s) to dirserver %s:%d

http status 400 (%s) response after uploading signatures to dirserver '%s:%d'. Please correct.

http status %d (%s) reason unexpected while uploading signatures to server '%s:%d').

Received rendezvous descriptor (size %d, status %d (%s))

http status 400 (%s). Dirserver didn't like our rendezvous query?

http status %d (%s) response unexpected while fetching hidden service descriptor (server '%s:%d').

Fetching v2 rendezvous descriptor failed: http status 400 (%s). Dirserver didn't like our v2 rendezvous query? Retrying at another directory.

Fetching v2 rendezvous descriptor failed: HTTP status %d (%s) response unexpected while fetching v2 hidden service descriptor (server '%s:%d'). Retrying at another directory.

Uploaded rendezvous descriptor (status %d (%s))

Uploading rendezvous descriptor: finished with status 200 (%s)

http status 400 (%s) response from dirserver '%s:%d'. Malformed rendezvous descriptor?

http status %d (%s) response unexpected (server '%s:%d').

conn reached eof, not reading. [state=%d] Closing.

Failed to decode requested authority digest %s.

rewritten url as '%s'.

Dumping %sdirectory to client.

Got a v2 rendezvous descriptor request for ID '%s'

Rejected v2 rend descriptor (length %d) from %s since we're not currently a hidden service directory.

Rejected v2 rend descriptor (length %d) from %s.

Problematic router descriptor or extra-info from %s ("%s").

Rejected router descriptor or extra-info from %s ("%s").

Rejected rend descriptor (length %d) from %s.

Unable to store signatures posted by %s: %s

Invalid input from address '%s'. Closing.

Got headers %s with unknown command. Closing.

called in unexpected state %d.

Dir connection to router %s:%u established.

Called with bad fingerprint in list: %s

Malformed fingerprint in list: %s

Skipping digest pair %s with non-standard length.

Skipping digest pair %s with missing dash.

Skipping non-decodable digest pair %s

Skipping digest %s with non-standard length.

Skipping non-decodable digest %s

%s failed %d time(s); I'll try again immediately.

%s failed %d time(s); I'll try again in %d seconds.

%s failed %d time(s); Giving up for a while.

%s: Network error

%s: Error downloading network status documents

%s: Error downloading router descriptors

%s: Error downloading certificates

%s: Sending request ...

Consensus URL: %s

%s: Downloading %s

%s: EOF

%s: Connection established

Couldn't decode fingerprint "%s"

Tried to add a mapping for reserved nickname %s

Reloading approved fingerprints from "%s"...

Cannot open fingerprint file '%s'. Failing.

Cannot open fingerprint file '%s'. That's ok.

Nickname '%s' too long in fingerprint file. Skipping.

Invalid nickname '%s' in fingerprint file. Skipping.

Invalid fingerprint (nickname '%s', fingerprint %s). Skipping.

Authorizing nickname '%s' would break many clients; skipping.

Authorizing nickname '%s' is not allowed; skipping.

Duplicate nickname '%s'.

%d fingerprints, %d digests known.

Good fingerprint for '%s'

Mismatched fingerprint for '%s'. ContactInfo '%s', platform '%s'.)

Marking '%s' as bad directory because of address '%s'

Marking '%s' as bad exit because of address '%s'

Rejecting '%s' because of address '%s'

Not marking '%s' valid because of address '%s'

Router '%s' published non-IP address '%s'. Refusing.

Router '%s' published internal IP address '%s'. Refusing.

Publication time for nickname '%s' is too far (%d minutes) in the future; possible clock skew. Not adding (%s)

Publication time for router with nickname '%s' is too far (%d minutes) in the past. Not adding (%s)

Router with nickname '%s' has invalid address '%s'. Not adding (%s).

Somebody attempted to publish a router descriptor '%s' (source: %s) with size %d. Either this is an attack, or the MAX_DESCRIPTOR_UPLOAD_SIZE (%d) constant is too low.

Not replacing descriptor from '%s' (source: %s); differences are cosmetic.

Did not add descriptor from '%s' (source: %s): %s.

Added descriptor from '%s' (source: %s): %s.

Somebody attempted to publish an extrainfo with size %d. Either this is an attack, or the MAX_EXTRAINFO_UPLOAD_SIZE (%d) constant is too low.

Router '%s' is now rejected: %s

Router '%s' is now %s.

write identity_pkey to string failed!

Removing too-old untrusted networkstatus in %s

Couldn't generate %s?

The %s is still clean; reusing.

New directory (size %d) has been built.

New directory (size %d):

Cutoffs: For Stable, %lu sec uptime, %lu sec MTBF. For Fast: %lu bytes/sec. For Guard: WFU %.03lf%%, time-known %lu sec, and bandwidth %lu or %lu bytes/sec. %s enough stability data.

Cannot get any descriptor for %s (wanted descriptor %s).

descriptor digest in routerlist does not match the one in routerstatus: %s vs %s (router %s)

Error computing signing key digest

Error computing identity key digest

Choosing valid-after time in vote as %s: consensus_set=%d, last_interval=%d

Writing public key to string failed.

Unable to get fingerprint for signing key

Generated a networkstatus %s we couldn't parse: <<%s>>

Don't know about any network status with fingerprint '%s'

Found router %s to be reachable at %s:%d. Yay.

Testing reachability of %s at %s:%u.

Generating consensus using method %d.

The other authorities will use consensus method %d, which I don't support. Maybe I should upgrade!

Conflict on naming for router: %s vs %s

The voters disagreed on the exit policy summary for router %s with descriptor %s. This really shouldn't have happened.

Not one of the voters that made us select descriptor %s for router %s had an exit policy summary

Wow, not one of the voters had an exit policy summary for %s. Wow.

Looking at signature from %s

We do not know any voter with ID %s

We already have a good signature from %s

Adding signature from %s

Not adding signature from %s

Choosing expected valid-after time as %s: consensus_set=%d, interval=%d

Scheduling voting. Known authority IDs are %s. Mine is %s.

Didn't find key/certificate to generate v3 vote

Can't generate v3 vote with expired certificate

Couldn't store my own vote! (I told myself, '%s'.)

We're missing votes from %d authorities. Asking every other authority for a copy.

Couldn't parse vote: length was %d

Got a vote from an authority (nickname %s, address %s) with authority key ID %s. This key ID is not recognized. Known v3 key IDs are: %s

We added a cert, but still couldn't find it.

Rejecting vote from %s with valid-after time of %s; we were expecting %s

We don't have enough votes to generate a consensus: %d of %d

Can't generate consensus without a certificate.

Could not add queued signature to new consensus: %s

Added %d pending signatures while building consensus.

Have %d signatures for adding to consensus.

Added %d signatures to consensus.

Got a signature from %s. Adding it to the pending consensus.

Got a signature from %s. Queuing it for the next consensus.

Not enough info to publish pending %s consensus

Error publishing %s consensus

Published %s consensus

This version of AdvOR requires AdvOR.dll version 0.1.0.7 or higher.

Error loading %s. Some features, like "Intercept" will be unavailable.

Advanced Onion Router v%s

Address: 127.0.0.1

Port: %d

127.0.0.1:%d

http://www.te-home.net/?do=work&id=advor

http://sourceforge.net/projects/advtor/files/

http://www.softpedia.com/get/Internet/Servers/WEB-Servers/Advanced-TOR.shtml

For feature requests and bug reports use one of the following forums:

http://www.te-home.net/?do=forum&id=advor

http://sourceforge.net/p/advtor/discussion/

Added to AddressMap: %s

Removed from AddressMap: %s

No exit node is currently in use. Use "Track exit for %s" option to associate a temporary exit node for %s .

The entry "%s" was not found in AddressMap

Expiring a dns resolve %s that's still pending. Forgot to cull it? DNS resolve didn't tell us about the timeout?

Forgetting old cached resolve (address %s, expires %lu)

The expired resolve we purged didn't match any in the cache. Tried to purge %s (%p); instead got %s (%p).

Rejecting invalid destination address %s

Bad .in-addr.arpa address "%s"; sending error.

Attempt to connect to a .in-addr.arpa address "%s"; sending error.

Connection (fd %d) waiting for pending DNS resolve of %s

Connection (fd %d) found cached answer for %s

Connection (fd %d) found cached error for %s

Launching %s.

Address %s is not pending. Dropping.

First connection (fd %d) no longer waiting for resolve of %s

Connection (fd %d) no longer waiting for resolve of %s

Address %s is not pending but has pending connections!

Address %s is pending but has no pending connections!

Failing all connections waiting on DNS resolve of %s

The cancelled resolve we purged didn't match any in the cache. Tried to purge %s (%p); instead got %s (%p).

Resolved unasked address %s; caching anyway.

Resolved %s which was already resolved; ignoring

The pending resolve we found wasn't removable from the cache. Tried to purge %s (%p); instead got %s (%p).

Unable to stat resolver configuration in '%s': %s

No change to '%s'

Parsing resolver configuration in '%s'

Unable to parse '%s', or no nameservers in '%s' (%d)

Unable to find any nameservers in '%s'.

Unable to find any platform nameservers in your Windows configuration.

eventdns said that %s resolves to ISP-hijacked address %s; treating as a failure.

eventdns said that %s resolves to %s

eventdns returned only non-IPv4 answers for %s.

eventdns returned no addresses or error for %s!

Launching eventdns request for %s

Launching eventdns reverse request for %s

Somehow a malformed in-addr.arpa address reached here.

eventdns rejected address %s: error %d.

Your DNS provider has given "%s" as an answer for %d different invalid addresses. Apparently they are hijacking DNS failures. I'll try to correct for this by treating future occurrences of "%s" as 'not found'.

Your DNS provider tried to redirect "%s" to a junk address. It has done this with %d test addresses so far. I'm going to stop being an exit node for now, since our DNS seems so broken.

Your DNS provider gave an answer for "%s", which is not supposed to exist. Apparently they are hijacking DNS failures. Trying to correct for this. We've noticed %d possibly %s so far.

Testing whether our DNS server is hijacking nonexistent domains with request for bogus hostname "%s"

eventdns rejected test address %s

Bad rep type %d on dns cache hash table

None of the questions we got were ones we're willing to support. Sending NOTIMPL.

Passing request for %s to rewrite_and_attach.

Passed request for %s to rewrite_and_attach.

Error from libevent when adding timer event for %s

Nameserver %s has failed: %s

Nameserver %s is back up

Got a SERVERFAILED from nameserver %s; will allow the request to time out.

Address mismatch on received DNS packet. Address was %s

Error %s (%d) while reading request.

Error %s (%d) while writing response to port; dropping

Error from libevent when adding event for %s

Sending probe to %s

Addrlen %d too long.

Successfully added %s as nameserver

Unable to add nameserver %s: error %d

Could not add nameserver %s to list, error: %d; status: %d

Trying to add nameserver <%s>

Nameserver port <%s> out of range

inet_pton(%s) failed

Resolve requested for %s

Resolve requested for %s (reverse)

Search: trying raw query %s

Search: now trying %s (%d)

Setting ndots to %d

Setting timeout to %d

Setting maximum allowed timeouts to %d

Setting maximum inflight requests to %d

Setting retries to %d

Setting randomize_case to %d

Parsing resolv.conf file %s

Could not open iphlpapi.dll

Found nameservers in %s/%s

Didn't find nameservers in %s/%s

Couldn't open nt key, %d

Couldn't open interfaces key, %d

Couldn't open registry key, %d

Unrecognized accounting unit '%s': only 'month', 'week', and 'day' are supported.

Accounting unit '%s' requires %d %s.

Error initializing keys

Configured hibernation. This interval begins at %s and ends at %s. We have no prior estimate for bandwidth, so we will start out awake and hibernate when we exhaust our quota.

Configured hibernation. This interval began at %s; the scheduled %s %s; %s to exhaust our quota for this interval around %s; the next interval begins at %s (all times local)

Successfully read bandwidth accounting info from state written at %s for interval starting at %s. We have been active for %lu seconds in this interval. At the start of the interval, we expected to use about %lu KB per second. (%I64u bytes read so far, %I64u bytes written so far)

%s; exiting now.

Closing listener type %d

Interrupt: will shut down in %d seconds. Interrupt again to exit now.

Closing conn type %d

Accounting period ended. Commencing hibernation until %s GMT

Accounting period ended. This period, we will hibernate until %s GMT

Commencing hibernation. We will wake up at %s local time.

new conn type %s, socket %d, address %s, n_conns %d.

removing socket %d (type %s), n_conns now %d

Error from libevent setting read event state for %d to unwatched: %s

Error from libevent setting read event state for %d to watched: %s

Error from libevent setting write event state for %d to unwatched: %s

Error from libevent setting write event state for %d to watched: %s

socket %d wants to read.

Unhandled error on read for %s connection (fd %d); removing

socket %d wants to write.

unhandled error on write for %s connection (fd %d); removing

Cleaning up connection (fd %d).

Conn (addr %s, fd %d, type %s, state %d) marked, but wants to flush %d bytes. (Marked at %s:%d)

Flushed last %d bytes from a linked conn; %d left; flushlen %d; wants-to-flush==%d

Holding conn (fd %d) open for more flushing.

We stalled too much while trying to write %d bytes to address %s. If this happens a lot, either something is wrong with your network connection, or something is wrong with theirs. (fd %d, type %s, state %d, marked at %s:%d).

Is your network connection down? Failing connection to '%s:%d'.

I learned some more directory information, but not enough to build a circuit: %s

Expiring wedged directory conn (fd %d, purpose %d)

Expiring non-used OR connection to fd %d (%s:%d) [Too old].

Expiring non-open OR connection to fd %d (%s:%d).

Expiring non-used OR connection to fd %d (%s:%d) [Hibernating or exiting].

Expiring non-used OR connection to fd %d (%s:%d) [idle %d].

Expiring stuck OR connection to fd %d (%s:%d). (%d bytes to flush; %d seconds since last write)

Sending keepalive to (%s:%d)

Rotating onion key.

Your server (%s:%d) has not managed to confirm that its ORPort is reachable. Please check your firewalls, ports, address, /etc/hosts file, etc.

Your server (%s:%d) has not managed to confirm that its DirPort is reachable. Please check your firewalls, ports, address, /etc/hosts file, etc.

Unrecognized signal number %d.

Caught sigpipe. Ignoring.

Rate limiting NEWNYM request: delaying by %d second(s)

In rephist: %I64u used by %d Tors.

Conn %d (socket %d) type %d (%s), state %d (%s), created %d secs ago

Conn %d is to %s:%d.

Conn %d: %d bytes waiting on inbuf (len %d, last read %d secs ago)

Conn %d: %d bytes waiting on outbuf (len %d, last written %d secs ago)

Conn %d: %d/%d bytes used on openssl read buffer; %d/%d bytes used on write buffer.

Average bandwidth: %I64u/%d = %d bytes/sec reading

Average bandwidth: %I64u/%d = %d bytes/sec writing

Clients don't have long-term identity keys. Exiting.

Error initializing keys; can't display fingerprint

Error: missing identity key.

Selected random OS version: %s

libevent call failed: %s [%d]

libevent call returned EINPROGRESS? Please report.

Skipping cached-status file with unexpected name "%s"

Couldn't load networkstatus from "%s"

Couldn't load consensus networkstatus from "%s"

Loaded fallback consensus networkstatus from "%s"

Consensus includes unrecognized authority '%s' at %s:%d (contact %s; identity %s)

Looks like we need to download a new certificate from authority '%s' at %s:%d (contact %s; identity %s)

Consensus does not include configured authority '%s' at %s:%d (identity %s)

%d unknown, %d missing key, %d good, %d bad, %d no signature, %d required

Couldn't write cached network status to "%s"

Network status from %s was published %s in the future (%s GMT). Check your time and date settings! Not caching.

Our clock is %s behind the time published in the consensus network status document (%s GMT). Tor needs an accurate clock to work correctly. Please check your time and date settings!

We received a network status with a fingerprint (%s) that we never requested. (We asked for: %s.) Dropping.

We do not recognize authority (%s) but we are willing to cache it.

Not replacing network-status from %s (published %s); we already have it.

Not replacing network-status from %s (published %s); we have a newer one (published %s) for this authority.

Setting networkstatus %s %s (published %s)

Removing too-old networkstatus in %s

The name %s is listed as Unnamed; it is not the canonical name of any server we know.

There are multiple matches for the nickname "%s", but none is listed as named by the directory authorities. Choosing one arbitrarily.

When looking up a status, you specified a server "%s" by name, but the directory authorities do not have any key registered for this nickname -- so it could be used by any server, not just the one you meant. To make sure you get the same server in the future, refer to it by key, as "$%s".

%s the most recent until %s and will expire at %s; fetching the next one at %s.

Not enough certificates to check networkstatus consensus

This version of Tor (%s) is newer than any recommended version%s, according to the directory authorities. Recommended versions are: %s

Please upgrade! This version of Tor (%s) is %s, according to the directory authorities. Recommended versions are: %s

Unrecognized purpose '%s' when listing router statuses.

Couldn't open advapi32.dll. Are you trying to use NT services on Windows 98? That doesn't work.

Couldn't find %s in advapi32.dll! We probably got the name wrong.

Unsupported command (--list-fingerint, --hash-password, or --verify-config) in NT service.

Illegal command number %d: internal error.

circ (p_circ_id %d) not in list, probably at cpuworker.

Couldn't decrypt onionskin: client may be using old onion key

Adding new entry '%s'

Malformed policy '%s'.

Unexpected result: %d

Unable to parse internally generated policy %s

Removing exit policy %s (%d). It is made redundant by %s (%d).

Removing exit policy %s. It is already covered by %s.

Still had %d address policies cached at shutdown.

Reason for ending (%d) not recognized.

Reason for ending (%d) not recognized; sending generic socks error.

Didn't recognize errno %d (%s); telling the client that we are ending a stream for 'misc' reason.

Unrecognized or_conn reason code %d

Didn't recognize errno %d (%s).

Unrecognized reason code %d

Passing on unrecognized cell.

found conn for stream %d.

delivering %d cell %s.

Sending a RELAY_EARLY cell; %d remaining.

Uh-oh. We're sending a RELAY_COMMAND_EXTEND cell, but we have run out of RELAY_EARLY cells on that circuit. Commands sent before: %s

Address '%s' refused due to '%s'. Considering retrying.

Address '%s' resolved to 0.0.0.0. Closing,

Address '%s' resolved to internal. Closing,

Exitrouter '%s' seems to be more restrictive than its exit policy. Not using this router as exit for now.

Have tried resolving or connecting to address '%s' at %d different places. Giving up.

Edge got end (%s) before we're connected. Marking for close.

'connected' received after %d seconds.

...but it claims the IP address was %s. Closing.

it is! %d

Got a resolve with answer %s. Rejecting.

Got an unexpected relay command %d, in state %d (%s). Dropping.

Now seen %d relay cells here.

Relay begin request unsupported at AP. Dropping.

circ deliver_window now %d.

data cell dropped, unknown stream (streamid %d).

end cell (%s) dropped, unknown stream.

%d: end cell (%s) for stream %d. Removing stream.

'extended' unsupported at non-origin. Dropping.

'truncate' unsupported at origin. Dropping.

'truncated' unsupported at non-origin. Dropping.

'connected' unsupported while open. Closing circ.

circ-level sendme at origin, packagewindow %d.

circ-level sendme at non-origin, packagewindow %d.

stream-level sendme, packagewindow now %d.

resolve request unsupported at AP; dropping.

resolve request on circ with purpose %d; dropping

'resolved' unsupported while open. Closing circ.

Received unknown relay command %d. Perhaps the other side is using a newer version of Tor? Dropping.

called with package_window %d. Skipping.

(%d) Packaging %d bytes (%d waiting).

conn->package_window is now %d

Outbuf %d, Queuing stream sendme.

considering circ->package_window %d

considering layer_hint->package_window %d

%d cells allocated on %d circuits. %d cells leaked.

Query '%s' didn't have valid rend desc in cache. Failing.

Could not find intro key for %s at %s; we have a v2 rend desc with %d intro points. Trying a different intro point...

Internal error: could not find intro key; we only have a v2 rend desc with %d intro points.

Internal error: couldn't hash public key.

Received REND_INTRODUCE_ACK on unexpected circuit %d.

...Found no rend circ. Dropping on the floor.

No introduction points left for %s. Closing.

Got nack for %s from %s. Re-extending circ %d, this time to %s.

Got nack for %s from %s. Building a new introduction circuit, this time to %s.

Sending fetch request for v2 descriptor for service '%s' with descriptor ID '%s', auth type %d, and descriptor cookie '%s' to hidden service directory '%s' on port %d.

Fetching rendezvous descriptor for service %s

Would fetch a new renddesc here (for %s), but one is already in progress.

Fetching v2 rendezvous descriptor for service %s

Malformed service ID %s.

Unknown service %s. Re-fetching descriptor.

No more intro points remain for %s. Re-fetching descriptor.

%d options left for %s.

Incorrect length (%d) on RENDEZVOUS2 cell.

Incorrect digest of key material.

Closing stream for '%s.onion': hidden service is unavailable (try again later).

Unknown router with nickname '%s'; trying another.

Configuration line does not consist of "onion-address authorization-cookie [service-name]": '%s'

Onion address has wrong format: '%s'

Authorization cookie has wrong length: '%s'

Decoding authorization cookie failed: '%s'

Could not compute v2 descriptor ID: Illegal service ID: %s

Could not compute v2 descriptor ID: Replica number out of range: %d

Could not compute v2 descriptor ID: Illegal characters in service ID: %s

Could not write onion key.

Could not write intro key.

Unable to generate random session key to encrypt introduction point string.

Could not encrypt session key for client.

Unrecognized authorization type %d

Could not encode introduction point string to base64. length=%d

Could not write public key to string.

Could not parse my own descriptor: %s

Signature is %d bytes too long on service descriptor.

Removing descriptor with ID '%s' from cache

Descriptor ID contains illegal characters: %s

Service descriptor %s is too old.

Service descriptor %s is too far in the future.

We already have a v2 descriptor for service %s.

We already have a newer service descriptor %s with the same ID and version.

We already have this service descriptor %s.

Successfully stored rend desc '%s', len %d.

Service descriptor with desc ID %s is not in interval that we are responsible for.

Successfully stored service descriptor with desc ID '%s' and len %d.

Parsed %d and added %d descriptor%s.

We already have a v0 descriptor for service ID %s.

Relay cell (rend purpose %d) from wrong hop on origin circ

Dropping cell (type %d) for wrong circuit type.

Received an ESTABLISH_INTRO request on circuit %d

Couldn't decode public key.

Replacing old circuit for service %s

Established introduction point on circuit %d for service %s

Received an INTRODUCE1 request on circuit %d

Rejecting INTRODUCE1 on non-OR or non-edge circuit %d.

Impossibly short INTRODUCE1 cell on circuit %d; responding with nack.

No intro circ found for INTRODUCE1 cell (%s) from circuit %d; responding with nack.

Sending introduction request for service %s from circ %d to circ %d

Received an ESTABLISH_RENDEZVOUS request on circuit %d

Established rendezvous point on circuit %d for cookie %s

Got request for rendezvous from circuit %d to cookie %s.

Tried to complete rendezvous on non-OR or non-edge circuit %d.

Rejecting RENDEZVOUS1 cell with bad length (%d) on circuit %d.

Rejecting RENDEZVOUS1 cell with unrecognized rendezvous cookie %s.

Unable to send RENDEZVOUS2 cell to client on circuit %d.

Completing rendezvous: circuit %d joins circuit %d (cookie %s)

Hidden service with no ports configured; ignoring.

Configuring service with directory "%s"

Service maps port %d to %s:%d

Bad syntax in hidden service port configuration.

Missing or invalid port %s in hidden service port configuration

Unparseable address in hidden service port configuration.

Unparseable or out-of-range port %s in hidden service port configuration.

%s with no preceding HiddenServiceKey directive

HiddenServiceAuthorizeClient contains unrecognized auth-type '%s'. Only 'basic' or 'stealth' are recognized.

HiddenServiceAuthorizeClient contains auth-type '%s', but no client names.

HiddenServiceAuthorizeClient contains %d duplicate client name(s); removing.

HiddenServiceAuthorizeClient contains an illegal client name: '%s'. Length must be between 1 and %d characters.

HiddenServiceAuthorizeClient contains an illegal client name: '%s'. Valid characters are [A-Za-z0-9 -_].

Adding client name '%s'

HiddenServiceAuthorizeClient contains %d client authorization entries, but only a maximum of %d entries is allowed for authorization type '%s'.

Closing intro point %s for service %s.

Loading hidden-service keys from "%s"

Directory name too long to store key file: "%s".

Couldn't compute hash of public key.

Directory name too long to store hostname file: "%s".

Directory name too long to store client keys file: "%s".

Previously stored client_keys file could not be parsed.

Parsed %d previously stored client entries.

Could not open client_keys file %s

Could not open hostname file %s

Error constructing client key

Error generating client key

Generated client key seems invalid

Could not append client entry to file: %s

Could not append host entry to file: %s

No authorization found for descriptor cookie '%s'! Dropping cell!

Client %s authorized for service %s.

Received INTRODUCE2 cell for service %s on circ %d.

Got an INTRODUCE2 over a non-introduction circuit %d.

Got a truncated INTRODUCE2 cell on circ %d.

Got an INTRODUCE2 cell for an unrecognized service %s.

Got an INTRODUCE2 cell for the wrong service (%s).

PK-encrypted portion of INTRODUCE2 cell was truncated.

Wrong auth data size %d, should be %d.

Unknown authorization type number: '%d'

INTRODUCE2 cell is too %s. Discarding.

Bad length %u for version %d INTRODUCE2 cell.

Error decoding onion key in version %d INTRODUCE2 cell.

Couldn't find a nul-padded nickname in INTRODUCE2 cell.

Bad nickname in INTRODUCE2 cell.

Couldn't find router %s named in introduce2 cell.

Bad length %u for INTRODUCE2 cell.

Possible replay detected! We received an INTRODUCE2 cell with same first part of Diffie-Hellman handshake %d seconds ago. Dropping cell.

Internal error: couldn't build DH state or generate public key.

Giving up launching first hop of circuit to rendezvous point %s for service %s.

Accepted intro; launching circuit to %s (cookie %s) for service %s.

Attempt to build circuit to %s for rendezvous has failed too many times or expired; giving up.

Reattempting rendezvous circuit to '%s'

Couldn't relaunch rendezvous circuit to '%s'.

Launching circuit to introduction point %s for service %s

Can't launch circuit to establish introduction at %s.

The intro circuit we just cannibalized ends at $%s, but we requested an intro circuit to $%s. Updating our service.

Unrecognized service ID %s on introduction circuit %d.

Established circuit %d as introduction point for service %s

Couldn't send introduction request for service %s on circuit %d

Unknown service on introduction circuit %d.

Received INTRO_ESTABLISHED cell on circuit %d for service %s

Done building circuit %d to rendezvous with cookie %s for service %s

Couldn't get DH public key.

Not sending publish request for v2 descriptor to hidden service directory '%s'; we don't have its router descriptor. Queuing for later upload.

Sending publish request for v2 descriptor for service '%s' with descriptor ID '%s' with validity of %d seconds to hidden service directory '%s' on port %d.

Sending publish request for hidden service %s

Giving up on %s as intro point for %s.

Could only establish %d introduction points for %s.

Picked router %s as an intro point for %s.

Error launching circuit to node %s for service %s.

Service configured in "%s":

Intro point %d at %s: no circuit

Intro point %d at %s: circuit is %s

beginning to hunt for addr/port

Couldn't find any service associated with pk %s on rendezvous circuit %d; closing.

No virtual port mapping exists for port %d on service %s

Router %s is now Running; it had been down since %s.

Router %s is still Running; it has been Running since %s

Router %s is now Running; it was previously untracked

Router %s is now non-Running: it had previously been Running since %s. Its total weighted uptime is %lu/%lu.

Router %s is now non-Running; it was previously untracked.

Router %s is still non-Running; it has been non-Running since %s.

OR %s [%s]: %ld/%ld good connections; uptime %ld/%ld sec (%.2f%%); wmtbf %lu:lu:lu

Relay '%s' is listed as up in rephist, but it's not in our routerlist. Correcting.

Couldn't scan line %s

Couldn't scan  MTBF line %s

Couldn't scan  WFU line %s

Couldn't hex string %s

Couldn't parse time %s

Could not parse '%s' into a number.'

Expiring predicted port %d

Unknown pk operation %d

PK operations: %lu directory objects signed, %lu directory objects verified, %lu routerdescs signed, %lu routerdescs verified, %lu onionskins encrypted, %lu onionskins decrypted, %lu client-side TLS handshakes, %lu server-side TLS handshakes, %lu rendezvous client operations, %lu rendezvous middle operations, %lu rendezvous server operations.

Error constructing rotated onion key

Error generating onion key

Couldn't write generated onion key to "%s".

Rotating onion key

Couldn't rotate onion key.

Error constructing key

Can't read key from "%s"

Another Tor process has locked "%s". Not writing any new keys.

No key found in "%s"; generating fresh key.

Generated key seems invalid

Generated key seems valid

Couldn't write generated key to "%s".

No key found in "%s"

Error loading private key.

No version 3 directory key found in %s

Signing key found, but no certificate found in %s

Unable to parse certificate in %s

Stored signing key does not match signing key in certificate

Your v3 authority certificate has expired. Generate a new one NOW.

Your v3 authority certificate expires in %d hours; Generate a new one NOW.

Your v3 authority certificate expires in %d days; Generate a new one soon.

We're configured as a V3 authority, but we were unable to load our v3 authority keys and certificate! Use tor-gencert to generate them. Dying.

Reading/making identity key "%s"...

Reading/making onion key "%s"...

Unable to add own descriptor to directory: %s

Dumping fingerprint to "%s"...

Your Tor server's identity key fingerprint is '%s %s'

Configured authority type does not match authority type in DirServer list. Adjusting. (%d v %d)

V3 identity key does not match identity declared in DirServer line. Adjusting.

Adding my own v3 cert

Unable to parse my own v3 cert! Failing.

Advertising DirPort as %d

Not advertising DirPort (Reason: %s)

Testing reachability of my ORPort

Testing bandwidth of my ORPort

Self-testing indicates your ORPort is reachable from the outside. Excellent.%s

ORPort found reachable, but I have no routerinfo yet. Failing to inform controller of success.

Self-testing indicates your DirPort is reachable from the outside. Excellent.

DirPort found reachable, but I have no routerinfo yet. Failing to inform controller of success.

Performing bandwidth self-test...done.

My desc is '%s'

I have no descriptor for the router named "%s" in my declared family; I'll use the nickname as is, but this may confuse clients.

There is a router named "%s" in my declared family, but that isn't a legal nickname. Skipping it.

Our IP Address has changed from %s to %s; rebuilding descriptor (source: %s).

Guessed our IP address as %s (source: %s).

Malformed X-Your-Address-Is header %s. Ignoring.

Got X-Your-Address-Is: %s.

A directory server told us our IP address is %s, but he's just reporting his own IP address. Ignoring.

Tried to sign a router with a private key that didn't match router's public key!

write onion_pkey to string failed!

We just generated a router descriptor we can't parse. Descriptor was: <<%s>>

Parsed certificate for %s

%s for %s that we already have.

Skipping cached certificate

Skipping downloaded certificate

Got a certificate for %s that we already have. Maybe they haven't updated it. Waiting for a while.

%s for directory authority %s with signing key %s

Adding cached certificate

Adding downloaded certificate

%s %s for unrecognized directory authority with signing key %s

cached certificate

downloaded certificate

Updating address for directory authority %s from %s:%d to %s:%d based on in certificate.

Error writing certificates to disk.

We're missing a certificate from authority with signing key %s: launching request.

No current certificate known for authority %s; launching request.

Rebuilding %s cache

Error replacing old router store: %s

We wrote some bytes to a new descriptor file at '%s', but when we went to mmap it, it was empty!

We just removed every descriptor in '%s'. This is okay if we're just starting up after a long time. Otherwise, it's a bug.

Unable to mmap new descriptor file at '%s'.

Couldn't read %s; trying to load routers from old location %s.

Nickname '%s' is misformed; skipping

Nickname list includes '%s' which isn't a known router.

Total weighted bw = %I64u, exit bw = %I64u, nonexit bw = %I64u, exit weight = %lf (for exit == %d), guard bw = %I64u, nonguard bw = %I64u, guard weight = %lf (for guard == %d)

We couldn't find any live%s%s%s routers; falling back to list of all routers.

There are multiple matches for the nickname "%s", but none is listed as named by the directory authorities. Choosing one arbitrarily. If you meant one in particular, you should say %s.

You specified a server "%s" by name, but this name is not registered, so it could be used by any server, not just the one you meant. To make sure you get the same server in the future, refer to it by key, as "$%s".

Descriptor at %p begins with unexpected string %s. Is another process running in our data directory? Exiting.

In %d live descriptors: %I64u bytes. In %d old descriptors: %I64u bytes.

Old descriptor for %s (published %s) %s, %s. Last valid until %s; last served at %s.

Marking router '%s/%s' %s.

Dropping descriptor that we already have for router '%s'

Received a no-longer-recognized descriptor for router '%s'

Skipping not-new descriptor for router '%s'

Replacing entry for router '%s/%s' [%s]

Forgetting obsolete (too old) routerinfo for router '%s'

We have %d live routers and %d old router descriptors.

Router's identity key matches mine; dropping.

Couldn't add router to list: %s Dropping.

Rejected: There is already a named server with this nickname and a different fingerprint.

%d elements to add

We received a router descriptor with a fingerprint (%s) that we never requested. (We asked for: %s.) Dropping.

Marking router %s as never downloadable

Unable to lookup address for directory server at '%s'

There are not many downloadable routerdescs, but we've been waiting long enough (%d seconds). Downloading.

Launching %d request%s for %d router%s, %d at a time

Requesting %d descriptors from authority "%s"

%d router descriptors listed in consensus are currently in old_routers; making them current.

Couldn't add re-parsed router: %s

%d router descriptors downloadable. %d delayed; %d present (%d of those were in old_routers); %d would_reject; %d wouldnt_use; %d in progress.

Extrainfo download status: %d router with no ei, %d with present ei, %d delaying, %d pending, %d downloadable.

%d usable, %d present.

Our directory information is no longer up-to-date enough to build circuits: %s

Country code '%s' is not valid, ignoring.

Country code '%s' is not recognized.

Adding identity %s to %s

Adding nickname %s to %s

Adding country %s to %s

Adding address %s to %s

Entry '%s' in %s is misformed.

We don't have a consensus, so we can't perform v2 rendezvous operations.

Not adding router '%s' to list of responsible hidden service directories, because we have no way of reaching it.

Area for %s has %lu allocated; using %lu.

Checking whether version '%s' is in '%s'

I couldn't parse my own version (%s)

Selected random Tor version: %s

Received directory hashes to %s

Unparseable dir-signing-key token

Dir-signing-key token did not parse as expected

Dir-signing-key token contained no key

Error computing dir-signing-key digest

Listed dir-signing-key is not trusted

Key on %s did not come from an authority; rejecting

Bad object type on %s signature

Error reading %s: invalid signature.

Error reading %s: signature does not match.

Read router '%s', purpose '%s'

%d *distinct* router digests verified

No router keyword found.

Router nickname is invalid

Invalid OR port %s

Invalid dir port %s

bandwidthrate %s unreadable or 0. Failing.

Invalid bandwidthburst %s

Invalid bandwidthcapacity %s

Invalid uptime %s

Couldn't calculate key digest

Couldn't decode router fingerprint %s

Fingerprint '%s' does not match identity digest.

Illegal nickname %s in family line

Invalid extra info digest %s

or_port unreadable or 0. Failing.

Bad nickname %s on "extra-info"

Invalid fingerprint %s on "extra-info"

Invalid published time %s on "extra-info"

No signature found on key certificate

No end-of-signature found on key certificate

Error tokenizing key certificate

Key certificate does not begin with a recognized version (3).

Couldn't decode key certificate fingerprint %s

Digest of certificate key didn't match declared fingerprint

Couldn't parse dir-address in certificate

Certificate didn't end with dir-key-certification.

We already checked the signature on this certificate; no need to do so again.

Invalid nickname %s in router status; skipping.

Error decoding identity digest %s

Error decoding descriptor digest %s

Error parsing time '%s %s'

Error parsing router address in network-status %s

Flags line had a flag %s not listed in known_flags.

Invalid Bandwidth %s

Unknown exit policy summary type %s.

Got a non-v2 networkstatus. Version was %s

Error parsing network-status source address %s

Directory source without dirport; skipping.

Couldn't decode networkstatus fingerprint %s

Couldn't compute signing key digest

network-status fingerprint did not match dir-signing-key

Unrecognized vote status %s in network-status

Bad element '%s' in params

Bad int element '%s' in params

Error decoding identity digest %s in network-status vote.

Mismatch between identities in certificate and vote

Error decoding IP address %s in network-status.

Error decoding vote digest %s in network-status consensus.

Invalid legacy key digest %s on vote.

Error decoding declared identity %s in network-status vote.

Error decoding declared digest %s in network-status vote.

Policy %s is too long.

Error reading address policy: %s

Couldn't parse line %s. Dropping

parse error: %s

parse error: Annotations mixed with keywords

Parse error: missing %s element.

Parse error: too many %s elements.

Parse error: first item is not %s.

Parse error: last item is not %s.

Missing %s [%d] in directory object that should have been validated. Internal error.

couldn't find start of hashed material "%s"

first occurrence of "%s" is not at the start of a line

couldn't find end of hashed material "%s"

cutoff version '%s' unparseable.

Router version '%s' unparseable.

Invalid descriptor ID: '%s'

Unrecognized descriptor version: %s

Invalid secret ID part: '%s'

Secret ID part contains illegal characters: %s

Invalid publication time: '%s'

Could not decrypt session key for client.

Identity digest contains illegal characters: %s

Introduction point onion port %s is invalid

Error tokenizing client keys file.

Impossibly short client key entry.

Illegal client name: %s. (Length must be between 1 and 19, and valid characters are [A-Za-z0-9 -_].)

HiddenServiceAuthorizeClient contains a duplicate client name: '%s'. Ignoring.

Descriptor cookie has illegal length: %s

Descriptor cookie contains illegal characters: %s

Impossibly long IP %s; rejecting

Malformed IP %s in address pattern; rejecting.

Bad number of mask bits (%d) on address range; rejecting.

IPv4-style mask %s is not a prefix address; rejecting.

Malformed mask on address range %s; rejecting.

Unexpected mask in address %s; rejecting

Wanted one port from address range, but there are two.

Unexpected ports in address %s; rejecting

Called with unknown address family %d

unable to create socket: %s

connect() failed: %s

getsockname() to determine interface failed: %s

Port %s out of range

Port %s given on %s when not required

Couldn't look up %s

Malformed port %s on address range; rejecting.

Insane port range on address policy; rejecting.

Mask %s on address range isn't a prefix; dropping

Malformed mask %s on address range; rejecting.

Could not open "%s" for mmap(): %s

File "%s" is empty. Ignoring.

Could not mmap file "%s": %s

Closing a socket (%d) that wasn't returned by tor_open_socket(), or that was already closed or something.

Close returned an error: %s

Our socket count is below zero: %d. Please submit a bug report.

I thought that %d was already open, but socket() just gave it to me!

We do not support more than %lu file descriptors on %s. Tried to raise to %lu.

Could not get maximum number of file descriptors: %s

Couldn't set maximum number of file descriptors: %s

ConnLimit must be at least %d. Failing.

User specified but switching users is unsupported on your OS.

User "%s" not found.

Error %d creating a mutex.

Error %d locking a mutex.

Error %d unlocking a mutex.

Error %d destroying a mutex.

Error freeing condition: %s

Failed to acquire mutex: %d

Error initializing windows network layer: code was %d

crypto error while %s: %s (in %s:%s)

crypto error: %s (in %s:%s)

Using OpenSSL engine %s [%s] for %s

Using default implementation for %s

setting symmetric key

generating RSA key

Error parsing private key

Error reading private key from "%s"

writing RSA key to string

reading public key from string

writing private key

checking RSA key

Error decrypting public-key data

No room for a symmetric key

encoding public key

decoding public key

generating DH key

Weird! Our own DH key was invalid. I guess once-in-the-universe chances really do happen. Trying again.

Weird! pubkey_len (%d) was smaller than DH_BYTES (%d)

DH key must be at least 2.

DH key must be at most p-2.

Rejecting insecure DH key [%s]

DH_compute_key() failed.

Seeding RNG from "%s"

Message from libevent: %s

Warning from libevent: %s

Error from libevent: %s

Message [%d] from libevent: %s

%I64u bytes in %d empty chunks

used chunk: %d items allocated

%I64u/%I64u bytes in %d partially full chunks

%I64u/%I64u bytes in %d full chunks

Gzip not supported with zlib %s

Error from deflateInit2: %s

Gzip compression didn't finish: %s

Error from inflateInit2: %s

Error from second inflateInit2: %s

Gzip decompression returned an error: %s

Gzip returned an error: %s

TLS error while %s%s%s: %s (in %s:%s)

TLS error%s%s: %s (in %s:%s)

TLS error: unexpected close while %s

TLS error:  (errno=%d: %s)

TLS connection closed while %s

OpenSSL %s looks like version 0.9.8l; I will try SSL3_FLAGS to enable renegotiation.

OpenSSL %s [%lx] looks like it's older than 0.9.8l, but some vendors have backported 0.9.8l's renegotiation code to earlier versions, and some have backported the code from 0.9.8m or 0.9.8n. I'll set both SSL3_FLAGS and SSL_OP just to be safe.

OpenSSL %s has version %lx

generating certificate

Error creating certificate

Got a non-version-1 cipher called '%s'

Got a non-version-1 cipher list from %s. It is: '%s'

List was: %s

Cipher %d: %lx %s

Skipping v2 cipher %s

Found cipher %s

Inserting fake %s

Got a TLS renegotiation from %s

read returned r=%d; TLS is closed

read returned r=%d, err=%d

resuming pending-write, (%d to flush, reusing %d)

Server sent back a single certificate; looks like a v2 handshake on %p.

getting peer certificate

Certificate %s: is your system clock set incorrectly?

printing certificate lifetime

(certificate lifetime runs from %s through %s. Your time is %s.)

getting certificate lifetime

Unexpected number of certificates in chain (%d)

No distinct identity certificate found

X509_verify on cert and pkey returned <= 0

checking certificate lifetime

Unhandled OpenSSL errors found at %s:%d:

mallinfo() said: arena=%d, ordblks=%d, smblks=%d, hblks=%d, hblkhd=%d, usmblks=%d, fsmblks=%d, uordblks=%d, fordblks=%d, keepcost=%d

Got invalid RFC1123 time %s

Got invalid RFC1123 time %s: No such month

Got invalid RFC1123 time %s. (Before 1970)

ISO time %s was unparseable

ISO time %s was nonsensical

Got invalid ISO time %s. (Before 1970)

Directory %s cannot be read: %s

Directory %s does not exist.

Creating directory %s

Error creating directory %s: %s

%s is not a directory

Couldn't open "%s" (%s) for writing: %s

Couldn't seek to end of file "%s": %s

Couldn't fdopen "%s" [%d]: %s

Error closing "%s": %s

Error flushing "%s": %s

Error replacing "%s": %s

Error writing to "%s": %s

Could not open "%s": %s

Could not fstat "%s".

Error reading from file "%s": %s

We didn't convert CRLF to LF as well as we hoped when reading %s. Coping.

Could read only %d of %ld bytes of file "%s".

Couldn't find $HOME environment variable while expanding "%s"

Couldn't get homedir for "%s"

pipe failed; exiting. Error was %s

chdir to "%s" failed. Exiting.

Unable to open "%s" for writing: %s

We have only %d/%d usable descriptors.

Only %d descriptor%s here and believed reachable!

Error loading AdvOR.dll in selected process, code:

- attempt to create a non-TCP socket (

There was an error creating AdvOR pipe. If there is another instance of same AdvOR, close it and try again.

Get a list with bridges from https://bridges.torproject.org

Bridges (IP:ORPort [fingerprint]) - each address on a separate line

Use encrypted directory connections (via ORPort instead of DirPort)

All HTTP directory requests will use this proxy:

Proxy account (username:password):

Error loading wininet.dll

The following bridges were downloaded from https://bridges.torproject.org:

&Select port

Local port

Rejecting request for address %s:%u because the exit %s was found in banlist .

Circuit ID %d

Purpose: %s

State: %d (%s)

Created: %s

Hop state: %s

awaiting keys

Country: %s

Address: %d.%d.%d.%d:%d

Router name: %s

Family: %s

Platform: %s

Contact info: %s

The nickname appears to be invalid.

This router claims to be a hidden service directory %s.

Connection type: %s /

State: %s

Address: %s

Actual address: %d.%d.%d.%d

Chosen exit: %s

Process ID: %u

Requested address: %s:%d

Final address: %s:%d

Last socks request: %s

Requested resource: %s

Router purpose: %s

%d routers could not be added.

The router %s from this circuit was found in banlist. Are you sure you want to launch this circuit ?

The router %s from this circuit was not found in router list.

There was an error while opening selected process - code: %d.

Use an existing .onion key

Paste here the private key for your hidden service:

All new connections will appear as originating from IP %d.%d.%d.%d .

All new connections will appear as originating from %s (%s).

&Ban %s (all positions)

Ban %s (e&xit)

Mark router %s as &invalid

Add &entry %s to favorites

A&dd exit %s to favorites

Kill process %s (PID: %u)

The router %s is already marked as invalid.

The router %s was marked as invalid.

- connection request for an address that was not found in AdvOR.dll's onion cache. This can happen when a process is re-intercepted and it keeps its own DNS cache with fake IPs given by previous instances of AdvOR.dll. You can wait until program's cache expires or you can restart the program.

An application is sending junk through AdvOR pipe. The following data was received:

A non-proxy HTTP request was sent for address %s. If your application is intercepted, something is blocking AdvOR.dll (known issue with Nod32).

Error loading plugin %s

The procedure AdvTor_InitPlugin() was not found in %s or it points to an invalid location.

The plugin %s cannot be loaded at this time (initialization failed).

No plugins were found - the directory %s does not exist.

No plugins were found - %s is not a directory.

The plugin %s is currently busy. Do you want to unload it anyway?

[%s] Rejecting request for banned address %s .

Save settings to AdvOR.ini

Unable to automap address %s

[%s] Attempt to use a reserved exclusivity key for a client connection to address %s .

Hot keys

The "Hide/Restore" hot key was unregistered successfully.

The "New Identity" hot key was unregistered successfully.

The "Intercept" hot key was unregistered successfully.

The "Release" hot key was unregistered successfully.

There was an error unregistering the "Hide/Restore" hot key.

There was an error unregistering the "New Identity" hot key.

There was an error unregistering the "Intercept" hot key.

There was an error unregistering the "Release" hot key.

The "Hide/Restore" hot key was registered successfully.

The "New Identity" hot key was registered successfully.

The "Intercept" hot key was registered successfully.

The "Release" hot key was registered successfully.

There was an error registering the "Hide/Restore" hot key.

There was an error registering the "New Identity" hot key.

There was an error registering the "Intercept" hot key.

There was an error registering the "Release" hot key.

The process %s is already intercepted.

The process %s is now intercepted. All new connections will go through the Tor network.

There was an error when trying to intercept some functions from the process %s. This usually happens if AdvOR was started from a restricted account.

Certificate is far too big (at %lu bytes long); rejecting

New password ...

Password

Enter the password that decrypts your configuration data:

Use this password:

Re-enter the password:

The password is a block of 4096 bytes from this file:

Passwords do not match.

Socks4, Socks5, HTTP, HTTPS (autodetected)

Enter exit node associations using this format: address address.exitname.exit

Always use same exits with these addresses until the identity is changed or until the exit association expires (add here addresses of file hosts that expect users to wait, eg.: .rapidshare.com ):

To start hosting a hidden service, start your server software that will host your hidden service and configure it to disable any settings that would cause it to reveal its real location (or, alternatively, you can intercept it). You start hosting a hidden service when you add it to the list of hidden services. Your service will be accessible through its associated .onion address (you may need to configure this .onion address in the server software you use).

The OR network relies on volunteers to donate bandwidth. The more people who run relays, the faster the OR network will be. If you have at least 20 kilobytes/s each way, please help out by configuring Advanced Onion Router to be a relay too. To do this, you must enter a port for your relay (default port is 9050). You are hosting an onion router when directory servers have your address in the list they share for OR clients (they may not immediately update their lists with your service).

Identity-specific generators for HTTP headers and for nicknames use identity seeds to ensure constant values during identity life time.

All processes that had HTTP OR connections and are still active are identified and their cookies and DOM storage (HTML5 cookies) are deleted.

Some websites may use some of Flash Player's features to track their visitors.

Generate new Windows Media Player client ID

Your Windows Media Player client ID is saved to AdvOR-undo.reg and the file is not overwritten. If some licensed material is no longer playable because of changing your unique ID, double click the .reg file to restore it.

Some applications have installed extensions / scripting languages that can be abused to bypass proxy restrictions to reveal your real IP. To make sure an application always uses its proxy settings, the application is intercepted and Winsock calls are redirected to AdvOR.dll.

Enable this option to make sure your real IP is not leaked when the program is using unsupported protocols.

When a program is intercepted its icon is changed by AdvOR.dll to help identifying intercepted processes.

Error opening the registry key %s

Current Windows Media Player client ID: %s

Windows Media Player client ID was saved to %s.

New Windows Media Player client ID: %s

Flash website personalization items deleted:

Flash history items removed from settings.sol :

Called Opera.dll to delete all cookies.

CFHTTPCookieStorageDeleteAllCookies(0): cookies deleted.

Reject requests for *.exitname.exit URL's

Reject requests for *.onion URL's

Remove dangerous HTTP headers (X-Forwarded-For, Client-IP, etc.)

Remove unknown HTTP headers

Show HTTP status

Chrome

Firefox

Opera

Original operating system (Windows)

Identity-dependent Windows (any version)

[%s] HTTP request headers:

[%s] Sending adjusted HTTP headers:

[%s] Downloading from %s

[%s] Received:

[%s] HTTP reply:

[%s] Download status: %s

The application %s is sending unrecognized HTTP headers: "%s"

The application %s is sending dangerous HTTP headers which may uniquely identify you. The headers were removed, but the application may use some extensions which can access this private data. The application sends: "%s"

[%s] Sending:

%s(%I64d) failed with error %s: Rounding up to 1970

%s(%I64d) failed with error %s: Rounding down to 2037

%s(%I64d) failed with error %s: can't recover

Unable to duplicate a %s key: openssl failed.

Called with unknown algorithm %d

I wanted to skip %d chunks in the freelist for %d-byte chunks, but only found %d. (Length %d)

Freelist length for %d-byte chunks may have been messed up somehow.

There were %d chunks at the start. I decided to keep %d. I wanted to free %d. I freed %d. I somehow think I have %d left to free.

Learned fingerprint %s for bridge %s:%d

Not using bridge at %s: it is in ExcludeNodes.

Adjusted bridge '%s' to match configured address %s:%d.

CircuitBuildTime learning is disabled. Consensus=%d, Config=%d, AuthDir=%d

Consensus parameter cbtclosequantile is too small, raising to %d

Consensus parameter cbtinitialtimeout is too small, raising to %d

The Tor Directory Consensus has changed how many circuits we must track to detect network failures from %d to %d.

Config CircuitBuildTimeout too low. Setting to %ds

Rewound history by %d places. Current index: %d. Total: %d

Circuit build time is too large (%u). This is probably a bug.

Adding circuit build time %u

Xm mode #%d: %u %u

The number of circuit times that this Tor version uses to calculate build times is less than the number stored in your state file. Decreasing the circuit time history from %lu to %d.

Replaced timeout %d with %d

We had %d timeouts out of %d build times, and filtered %d above the max of %u

Too many build times in state file. Stopping short before %d

Adding %d timeouts.

Corrupt state file? Build times count mismatch. Read %d times, but file says %d

Corrupt state file? Shuffled build times mismatch. Read %d times, but file says %d

Loaded %d/%d values from %d lines in circuit time histogram

Discrepancy in build times count: %d vs %d

Could not determine largest build time (%d). Xm is %dms and we've abandoned %d out of %d circuits.

Tor now sees network activity. Restoring circuit build timeout recording. Network was down for %d seconds during %d circuit attempts.

Circuit somehow completed a hop while the network was not live. Network was last live at %s, but circuit launched at %s. It's now %s.

Tor has not observed any network activity for the past %d seconds. Disabling circuit build timeout recording.

Got non-live timeout. Current count is: %d

Insanely large circuit build timeout value. (timeout = %fmsec, close = %fmsec)

Circuit build timeout of %dms is beyond the maximum build time we have ever observed. Capping it to %dms.

Your network connection speed appears to have changed. Resetting timeout to %lds after %d timeouts and %d buildtimes.

Circuit build measurement period of %dms is more than twice the maximum build time we have ever observed. Capping it to %dms.

Set buildtimeout to low value %fms. Setting to %dms

Based on %d circuit times, it looks like we don't need to wait so long for circuits to finish. We will now assume a circuit is too slow to use after waiting %ld seconds. Circuit timeout data: %fms, %fms, Xm: %d, a: %f, r: %f

Based on %d circuit times, it looks like we need to wait longer for circuits to finish. We will now assume a circuit is too slow to use after waiting %ld seconds. Circuit timeout data: %fms, %fms, Xm: %d, a: %f, r: %f

Set circuit build timeout to %lds (%fms, %fms, Xm: %d, a: %f, r: %f) based on %d circuit times

Circuit %d (purpose %d, %s) has timed out, yet has attached streams!

Extremely large value for circuit build timeout: %lds. Assuming clock jump. Purpose %d (%s)

Have %d clean circs need another buildtime test circ.

Ancient non-dirty circuit %d is still around after %ld milliseconds. Purpose: %d (%s)

The application request to %s:%d has launched %d circuits without finding one it likes.

Option '%s' used more than once; all but the last value will be ignored.

Can't set a DirPort on a bridge relay; disabling DirPort

Bad OwningControllerProcess: %s

Unix socket path '%s' is too long to fit.

getsockname() couldn't learn address for %s: %s

Invalid proxy protocol, %d

set state %s

The https proxy refused to allow connection to %s (status code %d, %s). Closing.

enter state %s

Invalid proxy_state for reading, %d

leaving state %s

Proxy Client: unable to connect to %s:%d (%s)

Proxy Client: unable to connect to %s:%d

Proxy Client: connection to %s:%d successful

Rejecting request for anonymous connection to private address %s on a TransPort or NATDPort. Possible loop in your NAT rules?

Rejecting SOCKS request for anonymous connection to private address %s

The ".exit" notation is disabled due to security risks. Set AllowTorHosts to 1 or 3 in your configuration to enable it.

Writing %s failed: %s

Control connection %d has taken ownership of this Tor instance.

Owning controller %s has %s -- shutting down.

Owning controller %s has %s -- exiting now.

Couldn't create process-termination monitor for owning controller: %s. Exiting.

Wanted to contact authority '%s' for %s, but it's in our ExcludedNodes list. Skipping.

Wanted to contact directory mirror %s for %s, but it's in our ExcludedNodes list. Skipping. This choice might make your Tor not work.

Rejected vote from %s ("%s").

Invalid line in bandwidth file: %s

Incomplete line in bandwidth file: %s

Double bw= in bandwidth file line: %s

Invalid bandwidth in bandwidth file line: %s

Double node_id= in bandwidth file line: %s

Invalid node_id in bandwidth file line: %s

Node ID %s not found in routerstatus list

Can't open bandwidth file at configured location: %s

Long or truncated time in bandwidth file: %s

Non-integer time in bandwidth file: %s

Bandwidth measurement file stale. Age: %u

Bandwidth measurement file successfully read. Applied %d measurements.

Unable to compute digest of legacy v3 identity key

Couldn't parse IP address "%s"

Insufficient memory for legacy-dir-key line

Bw weight mismatch %d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d Wmd=%d Wme=%d Wmg=%d Wed=%d Wee=%d Wgd=%d Wgg=%d Wme=%d Wmg=%d

Bw Weights error %d for %s v10. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d Wmd=%d Wme=%d Wmg=%d Wed=%d Wee=%d Wgd=%d Wgg=%d Wme=%d Wmg=%d weight_scale=%d

Bw Weights error %d for case %s. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Bw %s: Wgg=%I64d! G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Computed bandwidth weights for %s with v10: G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Computed bandwidth weights for %s with v9: G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Bad element '%s' in bw weight param

Couldn't generate a %s consensus at all!

Couldn't parse %s consensus we generated!

Our DNS cache has %d entries. Our DNS cache size is approximately %u bytes.

Unable to rotate keys after IP change!

Couldn't load all cached v3 certificates. Starting anyway.

Couldn't append to journal in %s: %s

Reloaded microdescriptor cache. Found %d descriptors.

Removed %d/%d microdescriptors as old.

Couldn't map file that we just wrote to %s!

Done rebuilding microdesc cache. Saved %d bytes; %d still used.

A consensus needs %d good signatures from recognized authorities for us to accept it. This one has %d (%s).

%d (%s) of the authorities we know didn't sign it.

It has %d signatures from authorities we don't recognize.

%d of the signatures on it didn't verify correctly.

We were unable to check %d of the signatures, because we were missing the keys.

Unrecognized consensus flavor %s

Got consensus with unexpected flavor %s (wanted %s)

Consensus parameter %s is too small. Got %d, raising to %d.

Consensus parameter %s is too large. Got %d, capping to %d.

Value of consensus weight %s was too large, capping to %d

Disabled cell_ewma algorithm because of value in %s

Enabled cell_ewma algorithm because of value in %s; scale factor is %f per %d seconds

No usable introduction points left for %s. Closing.

Re-extending circ %d, this time to %s.

Closing intro circ %d (out of RELAY_EARLY cells).

Marking for close dir conn fetching rendezvous descriptor for service %s

Received service descriptor for service ID %s; expected descriptor for service ID %s.

Another hidden service is already configured for directory %s, ignoring.

The only supported HiddenServiceVersion is 2.

Possible replay detected! We received an INTRODUCE2 cell with same PK-encrypted part %d seconds ago. Dropping cell.

Router %s still seems Running, but its address appears to have changed since the last time it was reachable. I'm going to treat it as having been down for %d seconds

Could not parse value '%s' into a number.'

Could not parse maximum '%s' into a number.'

Writing exit port statistics to disk.

Unable to write exit port statistics to disk!

Written %lu bytes and read %lu bytes to/from an exit connection to port %d.

Opened exit stream to port %d

Attempt to write cell statistics to disk failed. We haven't seen a single circuit to report about.

Can't peform self-tests for this relay: we have listed ourself in ExcludeNodes, and StrictNodes is set. We cannot learn whether we are usable, and will not be able to advertise ourself.%s

Success: chose address '%s'.

Decided to publish new relay descriptor: %s

Empty routerlist passed in to consensus weight node selection for rule %s

Empty routerlist passed in to old node selection for rule %s

Choosing node for rule %s based on weights Wg=%f Wm=%f We=%f Wd=%f with total bw %f

Weighted bandwidth is %f in node selection for rule %s

Round-off error in computing bandwidth had an effect on which router we chose. Please tell the developers. %f %I64u %f

Replacing non-bridge descriptor with bridge descriptor for router %s

Dropping bridge descriptor for %s because we have no bridge configured at that address.

Learned about %s (%s vs %s) from %s's vote (%s)

Unable to parse descriptor of type %s. See file unparseable-desc in data directory for details.

Relay's onion key had invalid exponent.

Invalid Measured Bandwidth %s

Wmm=%f != %I64d

Wem=%f != Wee=%f

Wgm=%f != Wgg=%f

Wed=%f != Weg=%f

Wgg=%f != %I64d - Wmg=%f

Wee=%f != %I64d - Wme=%f

Wgd=%f   Wmd=%f   Wed=%f != %I64d

Bw Weight Failure for %s: Etotal %f != Mtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Rtotal %f > Stotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Rtotal %f > T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Stotal %f > T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Mtotal %f < T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Etotal %f != Gtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Mtotal %f != Gtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: NStotal %f != Mtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*NStotal %f < T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bandwidth-weight %s is verified and valid.

Can't parse document with unknown flavor %s

Bad element '%s' in weight params

Error decoding declared signing key digest %s in network-status vote.

Unrecognized algorithm name %s

Multiple digests for %s with %s on detached signatures document

Two signatures with identical keys and algorithm found.

Strange value for circuit build time: %ldmsec. Assuming clock jump. Purpose %d (%s)

The ".onion" notation is disabled due to security risks. Set AllowTorHosts to 2 or 3 in your configuration to enable it.

Delete all SSL certificates that were used with SSL connections and generate new ones. All new connections will use the new SSL context.

There was an error while trying to download a list with bridges - your Internet Explorer may not recognize the authority that signed the certificate for https://bridges.torproject.org .

Do you want to retry ignoring unrecognized certification authorities ?

NTLM connect to '%s' successful! (200).

The NTLM proxy sent back an unexpected status code %d. Closing.

NTLM challenge: %s

The proxy requires an unsupported authentication method.

Account (username:password):

[%s] the server returned an invalid chunk size X

[%s] the client sent an invalid chunk size X

Unable to allocate HTTP authenticator. Not setting BridgePassword.

Got safe cookie authentication response with wrong length (%d)

We have only %d/%d usable exit node descriptors.

Accumulated too much data (%d bytes) on nonopen OR connection to %s:%u in state %s; closing.

Accumulated too much data (%d bytes) on nonopen OR connection from %s:%u in state %s; closing.

The "Hide All" hot key was unregistered successfully.

The "Restore All" hot key was unregistered successfully.

There was an error unregistering the "Hide All" hot key.

There was an error unregistering the "Restore All" hot key.

The "Hide All" hot key was registered successfully.

The "Restore All" hot key was registered successfully.

There was an error registering the "Hide All" hot key.

There was an error registering the "Restore All" hot key.

Rejecting null address with 0 port (family %d)

User:password

Generate an .onion address

You have entered a prefix for your new .onion address.

Bypass Tor blacklists

Some ideas for improving this feature include injecting public proxies after the exit node and opening more connections through different exit nodes to the same target in case the target doesn't flood the blacklist server with requests. Use our forums to post your suggestions for improving AdvOR's blacklist bypass abilities.

Enabling hidden service key %i (%s.onion)

Disabling hidden service key %i (%s.onion)

There is an error in default language file definitions, %d %s

Expected index: %d

%s-plugins\%s

-%s.lng

Error loading language file %s

Loaded language definitions %d

Format error in definition d:

Expected: %s

Found: %s

Windows 2000 Service Pack 4 [workstation]

Windows 2000 Service Pack 4 [server] {enterprise} {terminal services, single user} {terminal services}

Windows XP Service Pack 1 [workstation] {terminal services, single user}

Windows XP Service Pack 2 [workstation] {terminal services, single user}

Windows XP Service Pack 3 [workstation] {terminal services, single user}

Windows XP Service Pack 3 [workstation] {personal} {terminal services, single user}

Windows Server 2003 Service Pack 1 [server] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 1 [domain controller] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {enterprise} {terminal services}

Windows Server 2003 Service Pack 2 [server] {"blade" (2003, web edition)} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {datacenter} {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [domain controller] {enterprise} {terminal services, single user} {terminal services}

Windows "Longhorn" [workstation] {terminal services, single user}

Windows "Longhorn" Service Pack 1 [workstation] {terminal services, single user}

Windows "Longhorn" Service Pack 1 [server] {datacenter} {terminal services, single user} {terminal services}

Windows "Longhorn" Service Pack 1 [server] {terminal services, single user} {terminal services}

Windows "Longhorn" Service Pack 2 [workstation] {personal} {terminal services, single user}

Windows "Longhorn" Service Pack 2 [server] {"blade" (2003, web edition)} {terminal services, single user} {terminal services}

Very recent version of Windows [major=6,minor=1] [workstation] {terminal services, single user}

16:%s

Kernel32.dll

EXEC %s

?@last-listed %s

fast_memeq(md->body, "onion-key", 9)

cached-microdescs.new

CLOCK_SKEW MIN_SKEW=%ld SOURCE=NETWORKSTATUS:%s:%d

router_get_consensus_status_by_nickname

DANGEROUS_VERSION CURRENT=%s REASON=%s RECOMMENDED="%s"

dest_router_key

crypto_dh_get_bytes(handshake_state) == DH_KEY_LEN

%s:%s=

%s--%s

%s (%s)

%s %u

%s\*.dll

http://

https://

SOCKS_UNKNOWN_PROTOCOL DATA="%s"

HTTP/1.0 200 Connection established

ftp://

DANGEROUS_SOCKS PROTOCOL=SOCKS5 ADDRESS=%s:%d

DANGEROUS_SOCKS PROTOCOL=SOCKS4 ADDRESS=%s:%d

PID: %u, ID: %x

Remaining chunk: %x

Trailer: %x

conn->_base.state == AP_CONN_STATE_SOCKS_WAIT

Windows NT 5.0

Windows NT 5.1

Windows NT 5.2

Windows NT 6.0

Windows NT 6.1

x-operamini

proxy_http.c

Windows; U;

Mozilla/5.0 (

) AppleWebKit/

windows nt

Opera/9.80 (

Mozilla/5.0 (compatible; MSIE

%i Firefox/

(KHTML, like Gecko) Chrome/

Opera/9.i (

(.NET CLR 3.5.30729)

WebMoney Advisor

( .NET CLR 3.5.30729; .NET4.0C)

( .NET CLR 3.5.30729; .NET4.0E)

( .NET CLR 3.5.30729)

; YPC 3.2.0

; WebMoney Advisor

; FunWebProducts

Mozilla/4.0 (compatible; MSIE

; .NET CLR 2.0.50727

; .NET CLR 3.0.04506.30

; .NET CLR 1.1.4322

; .NET CLR 3.0.04506.648

; .NET CLR 3.0.30729

; .NET CLR 3.5.21022

Unrecognized response headers: %s

%s%s%s%s%s

Mozilla/5.0 (compatible; Yahoo! Slurp; http://help.yahoo.com/help/us/ysearch/slurp)

Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots)

[email protected]

bingbot(at)microsoft.com

msnbot/2.0b ( http://search.msn.com/msnbot.htm)

googlebot(at)googlebot.com

Mozilla/5.0 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)

Opera/

Firefox/

Chrome/

Browser: Opera

Browser: Firefox

Browser: Chrome

Changing host from %s to %s

HTTP/1.1 302 Found

Location: %s

x-orig-url:

x-opera-id:

x-opera-info:

x-opera-host:

0.0.0.0/8

169.254.0.0/16

127.0.0.0/8

192.168.0.0/16

10.0.0.0/8

172.16.0.0/12

%s%s%s %s

:%d-%d

reject %s:*

%d-%d

splice->_base.purpose == CIRCUIT_PURPOSE_REND_ESTABLISHED

introduction-point %s

ip-address %s

onion-port %d

%sservice-key

rendezvous-service-descriptor %s

permanent-key

%ssecret-id-part %s

publication-time %s

protocol-versions %s

%s-----END MESSAGE-----

service_key

circ->_base.purpose == CIRCUIT_PURPOSE_C_INTRODUCING

circ->_base.purpose == CIRCUIT_PURPOSE_C_ESTABLISH_REND

rendcirc->_base.purpose == CIRCUIT_PURPOSE_C_REND_READY

introcirc->_base.purpose == CIRCUIT_PURPOSE_C_INTRODUCING

parse_port_config

.dll:0

!strcasecmp(line->key, "HiddenServiceVersion")

rend_service_load_keys

client-name %s

descriptor-cookie %s

client-key

%s.onion %s # client: %s

oldcirc->_base.purpose == CIRCUIT_PURPOSE_S_CONNECT_REND

circuit->_base.purpose == CIRCUIT_PURPOSE_S_ESTABLISH_INTRO

circuit->_base.purpose == CIRCUIT_PURPOSE_S_CONNECT_REND

!crypto_pk_generate_key(intro->intro_key)

rend_service_set_connection_addr_port

circ->_base.purpose == CIRCUIT_PURPOSE_S_REND_JOINED

%i %s:%i

set_hs_key

(!at_addr && !at_port) || (at_addr && at_port)

%s [%s](%ld/%ld);

stored-at %s

 MTBF %lu %.5lf%s%s

 WFU %lu %lu%s%s

last-downrated %s

tracked-since %s

%s%s%s%s%s%swfu %0.3lf

total-run-weights %f

router %s %s %s

relevant-flags %s%s%s

router %s {no descriptor}

 MTBF %lu %lf S=s %8s

 WFU %lu %lu S=s %8s

@s %ld %lf S=s %8s

%s %s (%d s)

rep_hist_note_used_port

predicted_ports_list

predicted_ports_times

rep_hist_get_predicted_ports

exit-stats-end %s (%d s)

exit-kibibytes-written %s

exit-kibibytes-read %s

exit-streams-opened %s

%d=%I64u

%d=%u

other=%u

cell-stats-end %s (%d s)

cell-processed-cells %s

cell-queued-cells %s

cell-time-in-queue %s

cell-circuits-per-decile %d

get_onion_key

onionkey

dup_onion_keys

assert_identity_keys_ok

0!=crypto_pk_cmp_keys(client_identitykey, server_identitykey)

0==crypto_pk_cmp_keys(client_identitykey, server_identitykey)

server_identitykey

client_identitykey

get_server_identity_key

get_tlsclient_identity_key

rotate_onion_key

rotated onion key

init_key_from_file

load_authority_keyset

decide_to_advertise_dirport

EXTERNAL_ADDRESS ADDRESS=%s METHOD=DIRSERV

Tor %s on %s

router %s %s %d 0 %d

platform %s

opt fingerprint %s

bandwidth %d %d %d

%s%s%s%sonion-key

%ssigning-key

extra-info %s %s

is_legal_nickname

!body[desc_routerinfo->cache_info.signed_descriptor_len]

desc_routerinfo->cache_info.saved_location == SAVED_NOWHERE

init_keys

set onion key

strlen(options->Nickname) <= MAX_NICKNAME_LEN

router_dirport_found_reachable

REACHABILITY_SUCCEEDED DIRADDRESS=%s:%d

DirPort found reachable

router_orport_found_reachable

ORPort found reachable

REACHABILITY_SUCCEEDED ORADDRESS=%s:%d

%s: %s:%d.

trusted_dirs_flush_certs_to_disk

authority_cert_get_all

certs_out

router_nickname_is_in_list

router_get_by_nickname

"$%s" for the one at %s:%d

trusted_dirs_load_certs_from_string

ri->cache_info.routerlist_index == -1

tor_memeq(r->cache_info.identity_digest, d, DIGEST_LEN)

r->cache_info.routerlist_index == r_sl_idx

tor_memeq(ei->cache_info.signed_descriptor_digest, d, DIGEST_LEN)

tor_memeq(ei->cache_info.signed_descriptor_digest, sd->extra_info_digest, DIGEST_LEN)

authority_certs_fetch_missing

directory server "%s" at %s:%d

directory server at %s:%d

ri_new->cache_info.routerlist_index == -1

@purpose %s

Router's identity key matches mine.

Extrainfo signature was bad, or signed with wrong key.

Extrainfo nickname or identity did not match routerinfo

Extrainfo signature bad, or signed with wrong key

Contact %s, Platform %s

We have only %d/%d usable entry node descriptors.

add_nickname_list_to_smartlist

%s%.2f GB

%s%d B

%s%.2f kB

%s%.2f MB

D[%s%s] %d.%d.%d.%d (%s)

onion-port

service-key

signing-key

dir-key-certificate-version

dir-identity-key

dir-key-published

dir-key-expires

dir-key-crosscert

dir-key-certification

legacy-dir-key

Unable to parse descriptor of type %s:

_find_by_keyword

dir_signing_key_is_trusted

pkey

Wrong size on key for %s: %d bits

Too many arguments to %s

Missing public key for %s

Missing object for %s

Unexpected public key for %s

Too few arguments to %s

Private key given for %s, which wants a public key

Far too many arguments to %s

Unexpected object for %s

Malformed object: mismatched end tag %s

Public key given for %s, which wants a private key

RSA PUBLIC KEY

RSA PRIVATE KEY

Couldn't parse private key.

Couldn't parse public key.

find_dir_signing_key

opt dir-signing-key

authority_cert_parse_from_string

K_DIR_SIGNING_KEY

K_DIR_IDENTITY_KEY

authority cert

K_DIR_KEY_PUBLISHED

K_DIR_KEY_EXPIRES

tok->key

key certificate

key cross-certification

K_ONION_KEY

0.2.0.1-alpha

0.2.0.0-alpha-dev (r10070)

0.2.0.8-alpha

0.2.1.1-alpha

%s >= %s

Unknown digest algorithm %s; skipping

strlen(router->cache_info.signed_descriptor_body) == len

K_SIGNING_KEY

0.1.2.2-alpha

cp (end-start_of_annotations) == router->cache_info.signed_descriptor_body len

R_PERMANENT_KEY

R_IPO_ONION_PORT

R_IPO_ONION_KEY

R_IPO_SERVICE_KEY

rend_parse_client_keys

EXCEPTION_FLT_DENORMAL_OPERAND

EXCEPTION_FLT_INVALID_OPERATION

[%s]:

Unknown state: X, len: X

[%s%s%s%s]: X, len: X

FREE: X, len: X

RESERVED: X, len: X

[X:%i] X[X] ([%s%s%s%s]: X, len: X)

Previous: [X:%i] X[X]

Sentinel overwritten with X

No read access: X, len: X

BIG FUCKING ERROR X

AdvOR version: %s

Exception code: %s

Exception code: X

Address: X

Cause: %s address: X

EAX=X

EBX=X

ECX=X

EDX=X

CS =X

DS =X

ES =X

SS =X

ESI=X

EDI=X

EBP=X

ESP=X

DR0=X

DR1=X

DR2=X

DR3=X

DR6=X

DR7=X

FS =X

GS =X

EIP=X

EFlags=X

Do you want to save a crash report ?

Advanced Onion Router 0.3.0.20 - Error

%sX

dbghelp.dll

imagehlp.dll

[%s] %s%sPC=X, Return = X, SP=X, Params: X, X, X, X

AdvOR-crash.txt

Operation now in progress [WSAEINPROGRESS ]

Operation already in progress [WSAEALREADY ]

Socket operation on nonsocket [WSAENOTSOCK ]

Message too long [WSAEMSGSIZE ]

Protocol not supported [WSAEPROTONOSUPPORT ]

Socket type not supported [WSAESOCKTNOSUPPORT ]

Operation not supported [WSAEOPNOTSUPP ]

Protocol family not supported [WSAEPFNOSUPPORT ]

Address family not supported by protocol family [WSAEAFNOSUPPORT ]

Winsock.dll out of range [WSAVERNOTSUPPORTED ]

Windows

%3u.%3u.%3u.%3u%c

::%d.%d.%d.%d

::%x:%d.%d.%d.%d

Windows 8

Windows 7

Windows Vista

Windows Server 2003

Windows XP

Windows 2000

Windows Me

Windows 98

Windows NT 3.51

Bizarre version of Windows where GetVersionEx doesn't work.

Unrecognized version of Windows [major=%d,minor=%d] %s

Very recent version of Windows [major=%d,minor=%d] %s

Windows NT 4.0

Windows 95

Unable to lock memory pages. mlockall() unsupported?

%u.%u.%u%c%c

%u.%u%c%c

2.0.21-stable

[d-d-d d:d:d] [%s]

%s():

[...truncated]

Allocated memory: %u buffers, %u bytes

___, %d ___ %Y %H:%M:%S GMT

tm.tm_wday >= 0

tm.tm_mon <= 11

tm.tm_mon >= 0

tm.tm_wday <= 6

%Y-%m-%d %H:%M:%S

[%d similar message(s) suppressed in last %d seconds]

key_out

parse_http_time

%2u %3s %4u %2u:%2u:%2u GMT

%2u-%3s-%2u %2u:%2u:%2u GMT

%3s %3s %2u %2u:%2u:%2u %4u

%u-%2u-%2u %2u:%2u:%2u

%3s, %2u %3s %u %2u:%2u:%2u GMT

%d.%d.%d.%d.in-addr.arpa

.in-addr.arpa

.ip6.arpa

ip6.arpa

parse_port_range

port_max_out

port_min_out

tor_addr_parse_mask_ports

port > mask

tor_addr_port_parse

parse_addr_port

addrport

parse_addr_and_port_range

%d.%d.%d.%d

smartlist_join_strings2

join

keyp

msg != NULL

Monitored process %d is %s.

Successfully opened handle to monitored process %d.

Error "%s" occurred while polling handle for monitored process %d; assuming it's dead.

Failed to open handle to monitored process %d, and error code %lu (%s) is not 'invalid parameter' -- assuming the process is still alive.

Successfully opened handle to process %d; monitoring it.

Failed to open handle to process %d; will try again later.

chunk->next_mem >= chunk->u.mem

chunk->next_mem <= (char*) realign_pointer(chunk->u.mem chunk->mem_size)

1.2.8

tor_tls_create_certificate

Disabling SSLv3 because this OpenSSL version might otherwise be vulnerable to CVE-2011-4576 (compile-time version lx (%s); runtime version lx (%s))

OpenSSL 1.0.1e 11 Feb 2013

log_cert_lifetime

%b %d %H:%M:%S %Y GMT

try_to_extract_certs_from_tls

verifying certificate

?456789:;<=

!"#$%&'()* ,-./0123

_crypto_pk_env_get_evp_pkey

env->key

crypto_pk_generate_key_with_bits

crypto_pk_read_private_key_from_string

crypto_cipher_set_key

crypto_pk_write_key_to_string_impl

crypto_pk_read_public_key_from_string

crypto_pk_get_private_key_str

PRIVATE_KEY_OK(env)

crypto_pk_check_key

crypto_pk_key_is_private

crypto_pk_cmp_keys

PUBLIC_KEY_OK(b)

PUBLIC_KEY_OK(a)

crypto_pk_keysize

env->key->n

crypto_pk_dup_key

Duplicating a private key

Duplicating a public key

tolen >= crypto_pk_keysize(env)

tolen - outlen >= fromlen - pkeylen

key_len < INT_MAX

msg_len < INT_MAX

tor_check_dh_key

dh->dh->pub_key

crypto_expand_key_material

key_out_len <= DIGEST_LEN*256

pubkey_len < INT_MAX

crypto_cipher_generate_key

tolen >= fromlen   overhead   CIPHER_KEY_LEN

tolen >= pkeylen

secret_to_key

key_out_len <= DIGEST_LEN

key_out_len < SIZE_T_CEILING

deflate 1.2.8 Copyright 1995-2013 Jean-loup Gailly and Mark Adler

inflate 1.2.8 Copyright 1995-2013 Mark Adler

%s:%d: Assertion %s failed in %s

%s was called twice!

%s must be called *before* creating any events or event_bases

%s: Couldn't launch IOCP

%s: unknown queue %x

%s: %p(fd %I64d) not on queue %x

%s called on a non-initialized event %p (events: 0x%x, fd: %I64d, flags: 0x%x)

%s: event has no event_base set.

%s: noting a del on a non-setup event %p (events: 0x%x, fd: %I64d, flags: 0x%x)

%s: %p(fd %I64d) already on queue %x

%s: noting an add on a non-setup event %p (events: 0x%x, fd: %I64d, flags: 0x%x)

%s: reentrant invocation. Only one event_base_loop can run on each event_base at once.

%s called on an already added event %p (events: 0x%x, fd: %I64d, flags: 0x%x)

%s: calloc

%s: no base to free

%s: EV_SIGNAL is not compatible with EV_READ or EV_WRITE

%s: Too many common timeouts already in use; we only support %d per event_base

%s: realloc

%s: socketpair

%s: could not reinitialize event mechanism

EVENT_NO%s

%s: no event mechanism available

libevent using: %s

%s: Unable to make base notifiable.

%s: Unable to construct event_base

%p [fd %I64d]%s%s%s%s%s

Active events [priority %d]:

%p [fd %I64d]%s%s%s%s

Couldn't allocate %s

ev->ev_timeout_pos.min_heap_idx == i

[evdns] %s

%s: Couldn't allocate space for deferred callback.

server_port_free

!port->refcnt

!port->pending_replies

server_port_flush

_evthread_is_debug_lock_held((port)->lock)

req != port->pending_replies

server_port_read

Added nameserver %s as %p

Unable to parse nameserver address %s

google.com

cp   strlen("ip6.arpa") < buf sizeof(buf)

Giving up on request %p; tx_count==%d

Retransmitting request %p; tx_count==%d

Bad response %d (%s)

Got a SERVERFAILED from nameserverat %s; will allow the request to time out.

Address mismatch on received DNS packet. Apparent source was %s

Setting timeout to %s

Setting initial probe timeout to %s

Setting getaddrinfo-allow-skew to %s

config_nameserver_from_reg_key

127.0.0.1 localhost

iphlpapi.dll

Could not add nameserver %s to list,error: %d

System\CurrentControlSet\Services\Tcpip\Parameters

nt_key

System\CurrentControlSet\Services\VxD\MSTCP

win_key

interfaces_key

Sending request for %s on ipv4 as %p

Sending request for %s on ipv6 as %p

[%s] %s

Tried to mix edge-triggered and non-edge-triggered events on fd %d

Too many events reading or writing on fd %d

%s: recv

Added a signal to event base %p with signals already added to event_base %p. Only one can have signals at a time with the %s backend. The base with the most recently added signal or the most recent event_base_loop() call gets preference; do not rely on this behavior in future Libevent versions.

%s: received signal %d, but have no base configured

fcntl(%d, F_GETFL)

ai_socktype not supported

address family for nodename not supported

ai_family not supported

servname not supported for ai_socktype

%d.%d.%d.%d%c

18.244.0.188

Got a strange local ipv4 address %s

Got a strange local ipv6 address %s

[%s]:%d

OpenSSL 1.0.1g 7 Apr 2014

EXPORT

EXPORT40

EXPORT56

%-23s %s Kx=%-8s Au=%-4s Enc=%-9s Mac=%-4s%s

export

ssl_cert.c

%s/%s

s->init_num == (int)s->d1->w_msg_hdr.msg_len   DTLS1_HM_HEADER_LENGTH

((long)msg_hdr->msg_len) > 0

invalid state reached %s:%d

s->d1->w_msg_hdr.msg_len   ((s->version==DTLS1_VERSION)?DTLS1_CCS_HEADER_LENGTH:3) == (unsigned int)s->init_num

s->d1->w_msg_hdr.msg_len   DTLS1_HM_HEADER_LENGTH == (unsigned int)s->init_num

retransmit: message %d non-existant

os.length <= (int)sizeof(ret->session_id)

TLSv1 part of OpenSSL 1.0.1g 7 Apr 2014

SSLv3 part of OpenSSL 1.0.1g 7 Apr 2014

bad dh pub key length

bad ecc cert

certificate verify failed

cert length mismatch

ecc cert not for key agreement

ecc cert not for signing

ecc cert should have rsa signature

ecc cert should have sha1 signature

error generating tmp rsa key

https proxy request

http request

invalid ticket keys length

key arg too long

krb5 server rd_req (keytab perms?)

missing dh dsa cert

missing dh key

missing dh rsa cert

missing dsa signing cert

missing export tmp dh key

missing export tmp rsa key

missing rsa certificate

missing rsa encrypting cert

missing rsa signing cert

missing tmp dh key

missing tmp ecdh key

missing tmp rsa key

missing tmp rsa pkey

no certificates returned

no certificate assigned

no certificate returned

no certificate set

no certificate specified

no ciphers passed

no client cert method

no client cert received

Peer haven't sent GOST certificate, required for selected ciphersuite

no privatekey

no private key assigned

no publickey

null ssl method passed

peer did not return a certificate

peer error certificate

peer error no certificate

peer error unsupported certificate type

public key encrypt error

public key is not rsa

public key not rsa

reuse cert length not zero

reuse cert type not zero

signature for non signing certificate

sslv3 alert bad certificate

sslv3 alert certificate expired

sslv3 alert certificate revoked

sslv3 alert certificate unknown

sslv3 alert no certificate

sslv3 alert unsupported certificate

tlsv1 alert export restriction

tlsv1 bad certificate hash value

tlsv1 bad certificate status response

tlsv1 certificate unobtainable

tlsv1 unsupported extension

tls client cert req with anon cipher

tls illegal exporter label

tls peer did not respond with certificate list

tried to use unsupported cipher

unable to decode dh certs

unable to decode ecdh certs

unable to extract public key

unable to find public key parameters

unknown certificate type

unknown key exchange type

unknown pkey type

unsupported cipher

unsupported compression algorithm

unsupported digest type

unsupported elliptic curve

unsupported protocol

unsupported ssl version

unsupported status type

wrong number of key bits

CLIENT_CERTIFICATE

CLIENT_MASTER_KEY

DTLS1_ADD_CERT_TO_BUF

DTLS1_OUTPUT_CERT_CHAIN

DTLS1_SEND_CERTIFICATE_REQUEST

DTLS1_SEND_CLIENT_CERTIFICATE

DTLS1_SEND_CLIENT_KEY_EXCHANGE

DTLS1_SEND_SERVER_CERTIFICATE

DTLS1_SEND_SERVER_KEY_EXCHANGE

GET_CLIENT_MASTER_KEY

REQUEST_CERTIFICATE

SSL2_GENERATE_KEY_MATERIAL

SSL2_SET_CERTIFICATE

SSL3_ADD_CERT_TO_BUF

SSL3_CHECK_CERT_AND_ALGORITHM

SSL3_GENERATE_KEY_BLOCK

SSL3_GET_CERTIFICATE_REQUEST

SSL3_GET_CERT_STATUS

SSL3_GET_CERT_VERIFY

SSL3_GET_CLIENT_CERTIFICATE

SSL3_GET_CLIENT_KEY_EXCHANGE

SSL3_GET_KEY_EXCHANGE

SSL3_GET_SERVER_CERTIFICATE

SSL3_OUTPUT_CERT_CHAIN

SSL3_SEND_CERTIFICATE_REQUEST

SSL3_SEND_CLIENT_CERTIFICATE

SSL3_SEND_CLIENT_KEY_EXCHANGE

SSL3_SEND_SERVER_CERTIFICATE

SSL3_SEND_SERVER_KEY_EXCHANGE

SSL3_SETUP_KEY_BLOCK

SSL_add_dir_cert_subjects_to_stack

SSL_add_file_cert_subjects_to_stack

SSL_CERT_DUP

SSL_CERT_INST

SSL_CERT_INSTANTIATE

SSL_CERT_NEW

SSL_check_private_key

SSL_CHECK_SRVR_ECC_CERT_AND_ALG

SSL_CTX_check_private_key

SSL_CTX_set_client_cert_engine

SSL_CTX_use_certificate

SSL_CTX_use_certificate_ASN1

SSL_CTX_use_certificate_chain_file

SSL_CTX_use_certificate_file

SSL_CTX_use_PrivateKey

SSL_CTX_use_PrivateKey_ASN1

SSL_CTX_use_PrivateKey_file

SSL_CTX_use_RSAPrivateKey

SSL_CTX_use_RSAPrivateKey_ASN1

SSL_CTX_use_RSAPrivateKey_file

SSL_GET_SERVER_SEND_CERT

SSL_GET_SERVER_SEND_PKEY

SSL_GET_SIGN_PKEY

SSL_SESS_CERT_NEW

SSL_SET_CERT

SSL_SET_PKEY

SSL_use_certificate

SSL_use_certificate_ASN1

SSL_use_certificate_file

SSL_use_PrivateKey

SSL_use_PrivateKey_ASN1

SSL_use_PrivateKey_file

SSL_use_RSAPrivateKey

SSL_use_RSAPrivateKey_ASN1

SSL_use_RSAPrivateKey_file

SSL_VERIFY_CERT_CHAIN

tls1_cert_verify_mac

TLS1_EXPORT_KEYING_MATERIAL

TLS1_SETUP_KEY_BLOCK

DTLSv1 part of OpenSSL 1.0.1g 7 Apr 2014

server write key

client write key

key expansion

%s:%d: rec->data != rec->input

SSLv2 part of OpenSSL 1.0.1g 7 Apr 2014

s->session->master_key_length >= 0 && s->session->master_key_length < (int)sizeof(s->session->master_key)

GOST signature length is %d

c->iv_len <= (int)sizeof(s->session->key_arg)

s->s2->key_material_length <= sizeof s->s2->key_material

mType = %d

Flags = x

User = %s

Domain = %s

Wks = %s

sKey =

X.509 part of OpenSSL 1.0.1g 7 Apr 2014

OPENSSL_ALLOW_PROXY_CERTS

Public Key

%s algorithm "%s" unsupported

Private Key

Public key OCSP hash:

x%s

%s - d:d:d %d%s

%s - d:d:d%.*s %d%s

Certificate:

%8sVersion: %lu (0x%lx)

s%s

x%c

Issuer:%c

%s%lu (%s0x%lx)

Subject:%c

Subject Public Key Info:

sPublic Key Algorithm:

sUnable to load Public Key

passed a null parameter

x509 certificate routines

DSO support routines

error:lX:%s:%s:%s

Stack part of OpenSSL 1.0.1g 7 Apr 2014

cert_info

dhKeyAgreement

challengePassword

extendedCertificateAttributes

nsCertExt

Netscape Certificate Extension

nsCertType

Netscape Cert Type

nsBaseUrl

Netscape Base Url

nsRevocationUrl

Netscape Revocation Url

nsCaRevocationUrl

Netscape CA Revocation Url

nsRenewalUrl

Netscape Renewal Url

nsCaPolicyUrl

Netscape CA Policy Url

nsCertSequence

Netscape Certificate Sequence

subjectKeyIdentifier

X509v3 Subject Key Identifier

keyUsage

X509v3 Key Usage

privateKeyUsagePeriod

X509v3 Private Key Usage Period

certificatePolicies

X509v3 Certificate Policies

authorityKeyIdentifier

X509v3 Authority Key Identifier

extendedKeyUsage

X509v3 Extended Key Usage

TLS Web Server Authentication

TLS Web Client Authentication

pbeWithSHA1And3-KeyTripleDES-CBC

pbeWithSHA1And2-KeyTripleDES-CBC

keyBag

pkcs8ShroudedKeyBag

certBag

localKeyID

x509Certificate

sdsiCertificate

id-smime-mod-msg-v3

id-smime-ct-publishCert

id-smime-aa-msgSigDigest

id-smime-aa-encrypKeyPref

id-smime-aa-signingCertificate

id-smime-aa-smimeEncryptCerts

id-smime-aa-ets-otherSigCert

id-smime-aa-ets-CertificateRefs

id-smime-aa-ets-certValues

id-smime-aa-ets-certCRLTimestamp

id-mod-qualified-cert-88

id-mod-qualified-cert-93

id-mod-attribute-cert

id-it-caProtEncCert

id-it-signKeyPairTypes

id-it-encKeyPairTypes

id-it-caKeyUpdateInfo

id-it-unsupportedOIDs

id-it-keyPairParamReq

id-it-keyPairParamRep

id-it-revPassphrase

id-regCtrl-oldCertID

id-regCtrl-protocolEncrKey

id-regInfo-certReq

id-cmc-getCert

id-cmc-confirmCertAcceptance

id-ecPublicKey

set-msgExt

set-certExt

certificate extensions

setct-AcqCardCodeMsg

setct-PCertReqData

setct-PCertResTBS

setct-CertReqData

setct-CertReqTBS

setct-CertResData

setct-CertInqReqTBS

setct-AcqCardCodeMsgTBE

setct-CertReqTBE

setct-CertReqTBEX

setct-CertResTBE

setCext-certType

setCext-cCertRequired

setAttr-Cert

set-rootKeyThumb

JOINT-ISO-ITU-T

joint-iso-itu-t

msSmartcardLogin

Microsoft Smartcardlogin

proxyCertInfo

Proxy Certificate Information

certicom-arc

certificateIssuer

X509v3 Certificate Issuer

id-PasswordBasedMAC

password based MAC

id-Gost28147-89-CryptoPro-KeyMeshing

id-Gost28147-89-None-KeyMeshing

LocalKeySet

Microsoft Local Key set

supportedApplicationContext

userPassword

userCertificate

cACertificate

certificateRevocationList

crossCertificatePair

supportedAlgorithms

anyExtendedKeyUsage

Any Extended Key Usage

built on: %s

compiler: %s

platform: %s

x509_pkey

evp_pkey

ssl_cert

ssl_sess_cert

%s(%d): OpenSSL internal error, assertion failed: %s

ADVAPI32.DLL

KERNEL32.DLL

dh_key.c

Big Number part of OpenSSL 1.0.1g 7 Apr 2014

bn(%d,%d)

Diffie-Hellman part of OpenSSL 1.0.1g 7 Apr 2014

j <= (int)sizeof(ctx->key)

len>=0 && len<=(int)sizeof(ctx->key)

SHA-256 part of OpenSSL 1.0.1g 7 Apr 2014

SHA1 part of OpenSSL 1.0.1g 7 Apr 2014

CERTIFICATE REQUEST

NEW CERTIFICATE REQUEST

CERTIFICATE

PUBLIC KEY

DSA PRIVATE KEY

EC PRIVATE KEY

RSA part of OpenSSL 1.0.1g 7 Apr 2014

openssl.cnf

AES part of OpenSSL 1.0.1g 7 Apr 2014

EVP part of OpenSSL 1.0.1g 7 Apr 2014

lhash part of OpenSSL 1.0.1g 7 Apr 2014

crlUrl

certs

certId

certStatus

value.good

value.revoked

value.unknown

value.byName

value.byKey

reqCert

issuerKeyHash

OCSP_CERTID

OCSP_CERTSTATUS

%5lu file=%s, line=%d,

number=%d, address=lX

thread=%lu, file=%s, line=%d, info="

[d:d:d]

%ld bytes leaked in %d chunks

PEM part of OpenSSL 1.0.1g 7 Apr 2014

phrase is too short, needs to be at least %d chars

Enter PEM pass phrase:

ENCRYPTED PRIVATE KEY

PRIVATE KEY

ANY PRIVATE KEY

X509 CERTIFICATE

TRUSTED CERTIFICATE

eng_pkey.c

CERTIFICATE PAIR

pem_pkey.c

%s PRIVATE KEY

%s PARAMETERS

ec_key.c

xxxxxxxx

ASN.1 part of OpenSSL 1.0.1g 7 Apr 2014

SHA-512 part of OpenSSL 1.0.1g 7 Apr 2014

MD5 part of OpenSSL 1.0.1g 7 Apr 2014

pub_key

priv_key

ddddddZ

ddddddZ

d.otherName

d.rfc822Name

d.dNSName

d.directoryName

d.ediPartyName

d.uniformResourceIdentifier

d.iPAddress

d.registeredID

%*s%s:

%d.%d.%d.%d/%d.%d.%d.%d

value.set

value.single

DSA part of OpenSSL 1.0.1g 7 Apr 2014

public_key

X509_PUBKEY

x_pubkey.c

pkeyalg

PKCS8_PRIV_KEY_INFO

evp_pkey.c

key_enc_algor

enc_key

d.other

d.data

d.sign

d.enveloped

d.signed_and_enveloped

d.digest

d.encrypted

privateKey

publicKey

value.named_curve

value.parameters

value.implicitlyCA

p.other

p.prime

p.char_two

p.onBasis

p.tpBasis

p.ppBasis

EC_PRIVATEKEY

pubkey

%*sKey Id:

%sX

%*sAlias: %s

%s:%s

%*s%s

%*s

%lu:%s:%s:%d:%s

\X

keyid

X509_CERT_AUX

X509_CERT_PAIR

Key Compromise

keyCompromise

Cessation Of Operation

cessationOfOperation

Certificate Hold

certificateHold

name.fullname

name.relativename

%*sOnly User Certificates

%*sOnly CA Certificates

%*sOnly Attribute Certificates

AUTHORITY_KEYID

RAND part of OpenSSL 1.0.1g 7 Apr 2014

BYou need to read the OpenSSL FAQ, http://www.openssl.org/support/faq.html

%'%1%=%C%K%O%s%

.%.-.3.7.9.?.W.[.o.y.

C%C'C3C7C9COCWCiC

NETSCAPE_CERT_SEQUENCE

/usr/local/ssl/certs

/usr/local/ssl/cert.pem

SSL_CERT_DIR

SSL_CERT_FILE

CONF part of OpenSSL 1.0.1g 7 Apr 2014

certificate already present

certificate has no keyid

certificate verify error

error getting public key

error setting key

invalid encrypted key length

invalid key encryption parameter

invalid key length

msgsigdigest error

msgsigdigest verification failure

msgsigdigest wrong length

not key transport

not supported for this key type

no key

no key or cert

no msgsigdigest

no password

no private key

no public key

private key does not match certificate

signer certificate not found

unsupported content type

unsupported kek algorithm

unsupported key encryption algorithm

unsupported recipient type

unsupported recpientinfo type

unsupported type

CMS_add0_cert

CMS_add0_recipient_key

CMS_add0_recipient_password

CMS_add1_recipient_cert

CMS_decrypt_set1_key

CMS_decrypt_set1_password

CMS_decrypt_set1_pkey

CMS_EncryptedData_set1_key

CMS_GET0_CERTIFICATE_CHOICES

cms_msgSigDigest_add1

CMS_RecipientInfo_ktri_cert_cmp

CMS_RecipientInfo_set0_key

CMS_RecipientInfo_set0_password

CMS_RecipientInfo_set0_pkey

CMS_SIGNERINFO_VERIFY_CERT

error parsing url

no certificates in chain

unsupported requestorname type

OCSP_cert_id_new

OCSP_parse_url

PARSE_HTTP_LINE1

cmd not executable

failed loading private key

failed loading public key

invalid cmd name

invalid cmd number

unimplemented public key method

ENGINE_cmd_is_executable

ENGINE_ctrl_cmd

ENGINE_ctrl_cmd_string

ENGINE_get_pkey_asn1_meth

ENGINE_get_pkey_meth

ENGINE_load_private_key

ENGINE_load_public_key

ENGINE_load_ssl_client_cert

ENGINE_UNLOAD_KEY

ess add signing cert error

ess signing certificate error

invalid signer certificate purpose

unsupported md algorithm

unsupported version

ESS_ADD_SIGNING_CERT

ESS_CERT_ID_NEW_INIT

ESS_SIGNING_CERT_NEW_INIT

TS_CHECK_SIGNING_CERTS

TS_MSG_IMPRINT_set_algo

TS_REQ_set_msg_imprint

TS_RESP_CTX_set_certs

TS_RESP_CTX_set_signer_cert

TS_TST_INFO_set_msg_imprint

TS_VERIFY_CERT

functionality not supported

WIN32_JOINER

key gen error

unsupported pkcs12 mode

PKCS12_add_localkeyid

PKCS12_key_gen_asc

PKCS12_key_gen_uni

PKCS12_MAKE_KEYBAG

PKCS12_MAKE_SHKEYBAG

PKCS12_newpass

PKCS12_PBE_keyivgen

PKCS8_add_keyusage

extension setting not supported

no issuer certificate

no proxy cert policy language defined

operation not defined

policy syntax not currently supported

unable to get issuer keyid

unsupported option

R2I_CERTPOL

S2I_ASN1_SKEY_ID

S2I_SKEY_ID

V2I_AUTHORITY_KEYID

V2I_EXTENDED_KEY_USAGE

decrypted key is wrong length

encryption not supported for this key type

no recipient matches certificate

no recipient matches key

operation not supported on this type

signing not supported for this key type

unable to find certificate

unknown operation

unsupported cipher type

PKCS7_add_certificate

broken pipe

no accept port specified

no port defined

no port specified

unsupported method

BIO_get_port

ECDH_compute_key

data too large for key size

gf2m not supported

invalid private key

keys not set

missing private key

not a supported NIST prime

passed null parameter

unsupported field

d2i_ECPrivateKey

DO_EC_KEY_PRINT

ECKEY_PARAM2TYPE

ECKEY_PARAM_DECODE

ECKEY_PRIV_DECODE

ECKEY_PRIV_ENCODE

ECKEY_PUB_DECODE

ECKEY_PUB_ENCODE

ECKEY_TYPE2PARAM

EC_KEY_check_key

EC_KEY_copy

EC_KEY_generate_key

EC_KEY_new

EC_KEY_print

EC_KEY_print_fp

EC_KEY_set_public_key_affine_coordinates

i2d_ECPrivateKey

i2o_ECPublicKey

o2i_ECPublicKey

PKEY_EC_CTRL

PKEY_EC_CTRL_STR

PKEY_EC_DERIVE

PKEY_EC_KEYGEN

PKEY_EC_PARAMGEN

PKEY_EC_SIGN

zlib not supported

fips mode not supported

bad password read

digest and key type not supported

private key header missing

streaming not supported

unable to decode rsa key

unable to decode rsa private key

unknown public key type

unsupported any defined by type

unsupported encryption algorithm

unsupported public key type

wrong public key type

d2i_AutoPrivateKey

d2i_PrivateKey

d2i_PublicKey

d2i_X509_PKEY

i2d_DSA_PUBKEY

i2d_EC_PUBKEY

i2d_PrivateKey

i2d_PublicKey

i2d_RSA_PUBKEY

X509_PKEY_new

cant check dh key

cert already in hash table

key type mismatch

key values mismatch

loading cert dir

method not supported

no cert set for us to verify

public key decode error

public key encode error

unable to get certs public key

unknown key type

unsupported algorithm

ADD_CERT_DIR

GET_CERT_BY_SUBJECT

X509_check_private_key

X509_get_pubkey_parameters

X509_load_cert_crl_file

X509_load_cert_file

X509_PUBKEY_get

X509_PUBKEY_set

X509_REQ_check_private_key

X509_STORE_add_cert

X509_verify_cert

DSA_generate_key

PKEY_DSA_CTRL

PKEY_DSA_KEYGEN

error converting private key

expecting private key blob

expecting public key blob

keyblob header parse error

keyblob too short

problems getting password

public key no rsa

read key

unsupported encryption

unsupported key components

d2i_PKCS8PrivateKey_bio

d2i_PKCS8PrivateKey_fp

DO_PK8PKEY

DO_PK8PKEY_FP

PEM_F_PEM_WRITE_PKCS8PRIVATEKEY

PEM_PK8PKEY

PEM_READ_BIO_PRIVATEKEY

PEM_READ_PRIVATEKEY

PEM_WRITE_PRIVATEKEY

aes key setup failed

bad key length

bn pubkey error

camellia key setup failed

command not supported

ctrl operation not implemented

different key types

expecting an rsa key

expecting a dh key

expecting a dsa key

expecting a ecdsa key

expecting a ec key

invalid operation

keygen failure

no key set

no operation set

operation not supported for this keytype

operaton not initialized

private key decode error

private key encode error

unsuported number of rounds

unsupported keylength

unsupported key derivation function

unsupported key size

unsupported prf

unsupported private key algorithm

unsupported salt type

AESNI_INIT_KEY

AES_INIT_KEY

CAMELLIA_INIT_KEY

D2I_PKEY

DSAPKEY2PKCS8

DSA_PKEY2PKCS8

ECDSA_PKEY2PKCS8

ECKEY_PKEY2PKCS8

EVP_CIPHER_CTX_set_key_length

EVP_PKCS82PKEY

EVP_PKCS82PKEY_BROKEN

EVP_PKEY2PKCS8_broken

EVP_PKEY_copy_parameters

EVP_PKEY_CTX_ctrl

EVP_PKEY_CTX_ctrl_str

EVP_PKEY_CTX_dup

EVP_PKEY_decrypt

EVP_PKEY_decrypt_init

EVP_PKEY_decrypt_old

EVP_PKEY_derive

EVP_PKEY_derive_init

EVP_PKEY_derive_set_peer

EVP_PKEY_encrypt

EVP_PKEY_encrypt_init

EVP_PKEY_encrypt_old

EVP_PKEY_get1_DH

EVP_PKEY_get1_DSA

EVP_PKEY_GET1_ECDSA

EVP_PKEY_get1_EC_KEY

EVP_PKEY_get1_RSA

EVP_PKEY_keygen

EVP_PKEY_keygen_init

EVP_PKEY_new

EVP_PKEY_paramgen

EVP_PKEY_paramgen_init

EVP_PKEY_sign

EVP_PKEY_sign_init

EVP_PKEY_verify

EVP_PKEY_verify_init

EVP_PKEY_verify_recover

EVP_PKEY_verify_recover_init

FIPS_CIPHER_CTX_SET_KEY_LENGTH

PKCS5_PBE_keyivgen

PKCS5_v2_PBE_keyivgen

PKCS5_V2_PBKDF2_KEYIVGEN

PKEY_SET_TYPE

invalid public key

key size too small

COMPUTE_KEY

DH_compute_key

DH_generate_key

GENERATE_KEY

PKEY_DH_DERIVE

PKEY_DH_KEYGEN

data too small for key size

digest too big for rsa key

illegal or unsupported padding mode

invalid keybits

operation not allowed in fips mode

rsa operations not supported

unsupported mask algorithm

unsupported mask parameter

unsupported signature type

PKEY_RSA_CTRL

PKEY_RSA_CTRL_STR

PKEY_RSA_SIGN

PKEY_RSA_VERIFY

PKEY_RSA_VERIFYRECOVER

RSA_BUILTIN_KEYGEN

RSA_check_key

RSA_generate_key

RSA_generate_key_ex

Load certs from files in a directory

%s%clx.%s%d

PROXY_CERT_INFO_EXTENSION

Public-Key: (%d bit)

Private-Key: (%d bit)

PKCS#3 DH Private-Key

PKCS#3 DH Public-Key

%s: (%d bit)

private-key:

public-key:

recommended-private-length: %d bits

Private-Key

Public-Key

evp_key.c

nkey <= EVP_MAX_KEY_LENGTH

.pp@0

aEÐ

 (#EÚ

ÚE<<0

RC2 part of OpenSSL 1.0.1g 7 Apr 2014

DES part of OpenSSL 1.0.1g 7 Apr 2014

libdes part of OpenSSL 1.0.1g 7 Apr 2014

des(%s,%s,%s,%s)

TXT_DB part of OpenSSL 1.0.1g 7 Apr 2014

wrong number of fields on line %ld (looking for field %d, got %d, '%s' left)

ECDSA part of OpenSSL 1.0.1g 7 Apr 2014

rsa_keygen_bits

rsa_keygen_pubexp

hexkey

ECDH part of OpenSSL 1.0.1g 7 Apr 2014

othername:

email:%s

DNS:%s

X400Name:

EdiPartyName:

URI:%s

IP Address:%d.%d.%d.%d

Unprocessed type %d

ERROR: selector [%d] invalid

:EXTERNAL TYPE %s

%*s%s OF %s {

x -

%sx - 

cont [ %d ]

appl [ %d ]

priv [ %d ]

'() ,-./:=?

d.cpsuri

d.usernotice

CERTIFICATEPOLICIES

%*sCPS: %s

%*sExplicit Text: %s

%*sOrganization: %s

%*sNumber%s:

CONF_def part of OpenSSL 1.0.1g 7 Apr 2014

[%s] %s=%s

[[%s]]

keylen <= sizeof key

EVP_CIPHER_key_length(cipher) <= (int)sizeof(md_tmp)

%s %s%lu (%s0x%lx)

ASN1 OID: %s

Field Type: %s

Basis Type: %s

Key Encipherment

keyEncipherment

Key Agreement

keyAgreement

Certificate Sign

keyCertSign

v3_skey.c

PKEY_USAGE_PERIOD

v3_akey.c

EXTENDED_KEY_USAGE

%*scrlUrl:

%*sZone: %s, User:

%*sPolicy Text: %s

%s.dll

keylength

keyfunc

p12_key.c

RIPE-MD160 part of OpenSSL 1.0.1g 7 Apr 2014

SHA part of OpenSSL 1.0.1g 7 Apr 2014

MD4 part of OpenSSL 1.0.1g 7 Apr 2014

\CAST part of OpenSSL 1.0.1g 7 Apr 2014

Blowfish part of OpenSSL 1.0.1g 7 Apr 2014

x_pkey.c

d.allOrFirstTier

d.receiptList

d.signedData

d.envelopedData

d.digestedData

d.encryptedData

d.authenticatedData

d.compressedData

d.ktri

d.kari

d.kekri

d.pwri

d.ori

keyDerivationAlgorithm

keyEncryptionAlgorithm

encryptedKey

keyIdentifier

recipientEncryptedKeys

d.issuerAndSerialNumber

d.subjectKeyIdentifier

d.originatorKey

d.rKeyId

keyAttrId

keyAttr

certificates

d.crl

d.certificate

d.extendedCertificate

d.v1AttrCert

d.v2AttrCert

otherCertFormat

otherCert

CMS_OtherCertificateFormat

CMS_CertificateChoices

CMS_KeyTransRecipientInfo

CMS_OtherKeyAttribute

CMS_RecipientKeyIdentifier

CMS_KeyAgreeRecipientIdentifier

CMS_RecipientEncryptedKey

CMS_OriginatorPublicKey

CMS_OriginatorIdentifierOrKey

CMS_KeyAgreeRecipientInfo

CMS_PasswordRecipientInfo

Verifying - %s

value.other

value.keybag

value.shkeybag

value.safes

value.bag

value.x509cert

value.sdsicert

MIME-Version: 1.0%s

protocol="%ssignature";

filename="%s"%s

Content-Type: %smime;

smime-type=%s;

name="%s"%s

Content-Transfer-Encoding: base64%s%s

"; boundary="----%s"%s%s

This is an S/MIME signed message%s%s

------%s%s

%s------%s%s

Content-Type: %ssignature;

name="smime.p7s"%s

Content-Transfer-Encoding: base64%s

filename="smime.p7s"%s%s

%s------%s--%s%s

certs-only

-----BEGIN %s-----

-----END %s-----

VirtualQuery failed for %d bytes at address %p

Unknown pseudo relocation protocol version %d.

Unknown pseudo relocation bit size %d.

../../gcc-3.4.5/gcc/config/i386/w32-shared-ptr.c

0123456789

$DF02C2DE25397F8D3E019CB2F2A0A8E7161B0993~toxiroxiNL at 185.14.28.10

$96D505A9B411BB567A005277C66E0FDEE18D3D2B~96D505A9B411BB567A0 at 176.57.141.159

Windows XP Service Pack 3 [workstation]

185.14.28.10

Operation not permitted

Inappropriate I/O control opera

Broken pipe

AdvOR [exit(RO): 109.163.234.2 (hessel0)]

%Documents and Settings%\%current user%\AdvOR

\\.\pipe\AdvOR_nts_and_Settings_adm_AdvOR_exe

185.14.28.10: EOF

%Documents and Settings%\%current user%\AdvOR.ini

CreateIoCompletionPort

RegCloseKey

RegCreateKeyExA

RegOpenKeyExA

ReportEventA

EnumWindows

GetProcessWindowStation

RegisterHotKey

UnregisterHotKey

.text

p`.data

.rdata

`@.bss

.idata

.rsrc

COMCTL32.DLL

COMDLG32.DLL

GDI32.dll

msvcrt.dll

SHELL32.DLL

USER32.dll

WS2_32.DLL

% %@%H%P%`%`%d%g%h%p%x%

{ { {0{@{

Executable files (*.exe,*.pif,*.cmd,*.lnk)

*.exe;*.pif;*.cmd;*.lnk

*.txt

Localhost:443 Socks5/HTTPS

127.0.0.1:443 Socks5/HTTPS

AdvOR.exe

AdvOR.exe_120_rwx_00401000_00792000:

{(-t}

Portugal

Turkey

??????????ADADAEAFAFAFAFAGAIALAMANAOAOAOARARARASASATATAUAUAWAXAZAZAZAZAZAZBABABABBBDBEBEBEBEBEBEBFBFBFBGBGBGBHBIBIBJBMBNBNBOBOBRBSBTBTBWBWBWBYBYBYBZCACACACACACACCCDCDCDCDCFCFCGCGCGCHCHCHCHCICICICKCLCLCMCMCNCNCNCNCNCNCNCNCNCNCNCNCNCNCNCOCRCSCSCSCSCSCSCUCVCXCYCYCZDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDJDJDJDKDKDMDODZECEEEEEGERERERERERERETETETETETETETETETFIFIFIFJFJFKFMFOFOFRFRFRFRFRGAGBGBGBGBGBGBGBGBGBGBGDGEGEGEGFGHGHGHGHGIGLGLGMGMGMGNGPGQGRGTGUGUGWGYHKHKHKHKHNHRHRHTHTHUHUHUHUIDIDIDIEIEILILILILINININININININININININININININININININININIOIQIQIRIRIRISITITITITITJMJOJPKEKEKEKEKEKGKGKHKIKMKNKPKRKWKYKZKZKZKZLALBLBLCLILKLRLSLSLSLTLTLULULULVLVLYMAMCMDMDMDMDMDMGMGMHMHMKMKMLMLMMMNMOMOMOMPMPMQMRMRMSMTMTMUMVMWMWMXMYMYMZMZNANANANCNENENENENFNGNGNGNGNGNGNINLNLNLNONONONONONPNRNRNUNZNZOMPAPEPEPEPFPFPGPGPHPHPKPKPKPLPLPLPMPNPRPRPSPTPWPYPYQARERORORORORURURURURURURURURURURWRWRWSASBSCSCSDSDSDSESESESESESGSGSGSGSGSGSHSISISKSKSLSMSNSNSOSOSOSRSRSTSVSYSYSZSZTCTDTDTGTGTGTHTHTJTJTJTKTLTMTMTNTOTOTRTRTRTRTRTTTVTVTWTWTWTWTWTZUAUAUAUAUAUAUAUAUAUGUGUMUSUSUSUSUSUSUSUYUZUZUZUZUZVAVAVAVCVEVGVIVNVUVUVUWFWSWSYEYTYUYUYUZAZAZAZAZAZAZAZAZAZAZMZWZWZWZWZW

pipe

.PjFh

6-9'6-9'

$6.:$6.:

*?#1*?#1

>8$4,8$4,

AES for x86, CRYPTOGAMS by 

\$.Sj

SHA1 block transform for x86, CRYPTOGAMS by 

DlSHA512 block transform for x86, CRYPTOGAMS by 

RC4 for x86, CRYPTOGAMS by 

SHA256 block transform for x86, CRYPTOGAMS by 

3\$83|$<

Camellia for x86 by 

AES for Intel AES-NI, CRYPTOGAMS by 

tcPjXh`3

Montgomery Multiplication for x86, CRYPTOGAMS by 

Pj(j%S

Pj@j%S

GHASH for x86, CRYPTOGAMS by 

|$$ |$4)|$

GF(2^m) Multiplication for x86, CRYPTOGAMS by 

FtPWV

FtPU

FtPWW

9|$ }[ |$ 9

Advanced Onion Router v0.3.0.20

2004-2006, Roger Dingledine, Nick Mathewson

This product includes software developed by the OpenSSL Project for use in the OpenSSL Toolkit (http://www.openssl.org/), zlib (http://www.zlib.net/) and libevent (http://www.monkey.org/~provos/libevent/).

[2] Graphical Interface, extensions added to Tor client and AdvOR.dll are distributed under Creative Commons Attribution - NonCommercial - ShareAlike license ( http://creativecommons.org/licenses/by-nc-sa/3.0/ ).

SOFTWARE\Microsoft\Windows\CurrentVersion\Run

l}C.we

%s:%d: %s: Assertion %s failed; aborting.

pos.chunk_pos   pos.pos < INT_MAX

fetch_from_buf_http

%d %d

waiting for keys

%s%s circ (length %d%s%s):

%s(%s)

and DirPort %s:%d

circ->_base.state == CIRCUIT_STATE_BUILDING

CLOCK_JUMPED TIME=%d

CIRCUIT_NOT_ESTABLISHED REASON=%s

key_data

hop->state == CPATH_STATE_AWAITING_KEYS

circuit_all_predicted_ports_handled

router_handles_some_port

port

%s %s

%s %s %s

%s [%s] (%s, %s)

%s [%s] (up %s)

Unable to parse entry nodes: Bad nickname for EntryGuard

0.1.0.10-alpha

0.1.2.16-dev

0.2.0.0-alpha

0.2.0.6-alpha

old_conn->_base.magic == OR_CONNECTION_MAGIC

unknown state [%d]

UNKNOWN_%d

other->_base.magic == OR_CIRCUIT_MAGIC

conn->_base.type == CONN_TYPE_EXIT

[%s][%s] %s_%d - %s

purpose == CIRCUIT_PURPOSE_C_GENERAL || purpose == CIRCUIT_PURPOSE_C_INTRODUCE_ACK_WAIT || purpose == CIRCUIT_PURPOSE_C_REND_JOINED

?circuit_remove_handled_ports

circuit_remove_handled_ports

*port

REACHABILITY_FAILED ORADDRESS=%s:%d

conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT

%s.%s.exit

conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT || conn->_base.state == AP_CONN_STATE_CONTROLLER_WAIT

circ->_base.state == CIRCUIT_STATE_OPEN

ControlPort

If set, Tor will accept connections from the same machine (localhost only) on this port, and allow those connections to control the Tor process using the Tor Control Protocol (described in control-spec.txt).

If this option is set to 1, don't allow any connections to the control port except when the connecting process can read a file that Tor creates in its data directory.

Tor only trusts directories signed with one of these servers' keys. Used to override the standard list of directory authorities.

Force Tor to make all HTTP directory requests through this host:port (or host:80 if port is not set).

A username:password pair to be used with DirProxy.

Force Tor to make all TLS (SSL) connectinos through this host:port (or host:80 if port is not set).

A username:password pair to be used with ORProxy.

If non-zero, when a directory server we contact supports it, we will build a one-hop circuit and make an encrypted connection via its ORPort.

If set to 1, Tor will under no circumstances run as a server, even if ORPort is enabled.

If set, Tor will only create outgoing connections to servers running on the ports listed in FirewallPorts.

FirewallPorts

A list of ports that we can connect to. Only used when FascistFirewall is set.

LongLivedPorts

A list of ports for services that tend to require high-uptime connections.

Addresses we can connect to, as IP/bits:port-port. By default, we assume all addresses are reachable.

SOCKSPort

The port where we listen for SOCKS connections from applications.

Set an entry policy to limit which addresses can connect to the SOCKSPort.

If set, Tor will fail to operate when none of the configured ExitNodes can be used.

If set, Tor will fail to operate when none of the configured EntryNodes can be used.

Address/port ranges for which to accept or reject outgoing connections on behalf of Tor users.

Nickname

Set the server nickname.

How many processes to use at once for public-key crypto.

ORPort

Advertise this port to listen for connections from Tor clients and servers.

Bind to this address to listen for connections from clients and servers, instead of the default 0.0.0.0:ORPort.

DirPort

Serve directory information from this port, and act as a directory cache.

DirPortFrontPage

Serve a static html disclaimer on DirPort.

Bind to this address to listen for connections from clients and servers, instead of the default 0.0.0.0:DirPort.

Set a policy to limit who can connect to the directory port.

Programs added to "Quick Start" menu can be executed with "Force TOR" enabled.

Programs added to "Quick Start" menu can be executed with "Force TOR" enabled and when AdvOR exits it will also close them, or when one of those programs exits, AdvOR will close the rest of them and will exit.

Plugins that can be used by Advanced Onion Router must be placed in %[exename]-plugins\ directory. For more information about writing plugins, see plugins.txt.

How many times will a hidden service operator attempt to connect to a requested rendezvous point before giving up.

FirewallPort

LongLivedPort

HashedControlPassword

__HashedControlSessionPassword

.onion,.exit

BridgePassword

DNSPort

ExitPortStatistics

HiddenServiceKey

HiddenServicePort

NatdPort

RejectPlaintextPorts

www.google.com,www.mit.edu,www.yahoo.com,www.slashdot.org

SocksPort

TransPort

V3AuthUseLegacyKey

127.192.0.0/10

WarnPlaintextPorts

23,109,110,143

HTTPFlags

HTTPAgent

HTTPOS

0.2.2.39

HotkeyRestore

HotkeyNewIdentity

HotkeyIntercept

HotkeyRelease

HotkeyHideAll

HotkeyRestoreAll

LastRotatedOnionKey

The last time at which we changed the medium-term private key used for building circuits.

We've been configured to use (or avoid) nodes in certain contries, and we need GEOIP information to figure out which ones they are.

options && key

EXTERNAL_ADDRESS ADDRESS=%s METHOD=%s %s%s

validate_ports_csv

orport=

%s%s%s%s

%s=%s

Tor %s

Unix domain sockets (ControlSocket) not supported on this OS/with this build.

Failed to bind one of the listener ports.

BAD_LIBEVENT VERSION=%s METHOD=%s BADNESS=%s RECOVERED=NO

--hash-password

Advanced Onion Router version %s.

0.3.0.20

--exec

unknown [%d]

unknown state [%d] on unknown [%s] connection

TOO_MANY_CONNECTIONS CURRENT=%d

%s now %d.

0.0.0.0

127.0.0.1

Chosen Or/DirPort changed

.virtual

.exit

Can't specify ports on VirtualAddressNetwork

%s %s NEVER

%s %s "%s"

REVERSE[%s]

conn->_base.type == CONN_TYPE_AP

ap_conn->_base.state == AP_CONN_STATE_CIRCUIT_WAIT

ap_conn->_base.type == CONN_TYPE_AP

circ->_base.purpose == CIRCUIT_PURPOSE_C_GENERAL

circ->_base.timestamp_dirty

%s:%d

consider_plaintext_ports

DANGEROUS_PORT PORT=%d RESULT=%s

.%s.exit

SOCKS_BAD_HOSTNAME HOSTNAME=%s

conn->_base.state == AP_CONN_STATE_NATD_WAIT

edge_conn->_base.type == CONN_TYPE_EXIT

conn->_base.magic == OR_CONNECTION_MAGIC

conn->_base.type == CONN_TYPE_OR

msg_out

has_cert

conn->_base.state == OR_CONN_STATE_TLS_HANDSHAKING

PROXY_HTTPS_WANT_CONNECT_OK

Address type not supported

Command not supported

server doesn't support any of our available authentication methods

CONNECT %s:%d HTTP/1.0

CONNECT %s:%d HTTP/1.1

Host: %s:%d

Proxy-Authorization: Basic %s

connection_read_https_proxy_response

HTTP/1.%u %u

Authorization: NTLM %s

Router descriptors by nickname.

Brief summary of router status by nickname (v2 directory format).

Breakdown of bytes transferred over DirPort.

Router descriptors as retrieved from a DirPort.

v2 networkstatus docs as retrieved from a DirPort.

v3 Networkstatus consensus as retrieved from a DirPort.

control_ports_write_to_file

PORT=%s:%d

%s: %s

decode_hashed_passwords

passwords

515 Authentication failed: %s

551 Invalid quoted string. You need to put the password in double quotes.

Password did not match HashedControlPassword *or* authentication cookie.

Password did not match HashedControlPassword value from configuration

Password did not match HashedControlPassword value from configuration. Maybe you tried a plain text password? If so, the standard requires that you put it in double quotes.

551 Invalid hexadecimal encoding. Maybe you tried a plain text password? If so, the standard requires that you put it in double quotes.

Couldn't decode HashedControlPassword value in configuration.

512-syntax error: mapping '%s' is not of expected form 'foo=bar'.

250-%s=%s

512-syntax error: invalid address '%s'

250-%s

451-resource exhausted: skipping '%s'

/tor/%s

%s%s -- %s

552-Unrecognized key "%s"

552 Unrecognized key "%s"

250 %s=

250-%s=

551 %s

getinfo_items[i].fn

512 Too many arguments to %s

512 Missing argument to %s

552 Bad value hop=%s

552 Unknown stream "%s"

552 Unknown circuit "%s"

551 Circuit doesn't have %d hops.

552 Unknown purpose "%s"

251 %s

512 Unexpected argument "%s" to postdescriptor

554 %s

552 Unknown cache request "%s"

512 Cannot parse port "%s"

552 Unrecognized reason "%s"

250-AUTH METHODS=%s%s%s

250-VERSION Tor=%s

HASHEDPASSWORD

513 No such version %s

250 AUTHCHALLENGE SERVERHASH=%s SERVERNONCE=%s

513 AUTHCHALLENGE only supports SAFECOOKIE authentication

552 Unrecognized feature "%s"

PURPOSE=%s

650 CIRC %lu %s%s%s %s

REASON=%s

REASON=DESTROYED REMOTE_REASON=%s

552 No such router "%s"

%s%s%s:%d

.onion

REASON=UNKNOWN_%d

650 STREAM %I64u %s %lu %s%s%s%s

SOURCE_ADDR=%s:%d

REASON=END REMOTE_REASON=%s

UNKNOWN_%d

len > MAX_VERBOSE_NICKNAME_LEN

%lu %s%s%s PURPOSE=%s

%lu %s %lu %s

OR=%d DIR=%d

%sNCIRCS=%d

650 ORCONN %s %s %s%s%s

650 NEWDESC %s

650 ADDRMAP %s %s NEVER %s

650 ADDRMAP %s %s "%s" %s%sEXPIRES="%s"

The v0 control protocol is not supported by Tor 0.1.2.17 and later; upgrade your controller.

552-Unrecognized configuration key "%s"

552 Unrecognized configuration key "%s"

conn->_base.state == CONTROL_CONN_STATE_OPEN || conn->_base.state == CONTROL_CONN_STATE_NEEDAUTH

data_len>(size_t)cmd_len

552 Unrecognized event "%s"

552 Unrecognized signal code "%s"

510 Unrecognized command "%s"

650 BUILDTIMEOUT_SET %s TOTAL_TIMES=%lu TIMEOUT_MS=%lu XM=%lu ALPHA=%f CUTOFF_QUANTILE=%f TIMEOUT_RATE=%f CLOSE_MS=%lu CLOSE_RATE=%f

650 %s %s

BUG REASON="%s"

650 GUARD ENTRY %s %s

$%s~%s

loading_keys

BOOTSTRAP PROGRESS=%d TAG=%s SUMMARY="%s"

NOTICE %s

WARN %s

BOOTSTRAP PROGRESS=%d TAG=%s SUMMARY="%s" WARNING="%s" REASON=%s COUNT=%d RECOMMENDATION=%s

650 CLIENTS_SEEN %s

Tor 0.2.0.0-alpha-dev (r10070)

conn->_base.purpose == DIR_PURPOSE_FETCH_SERVERDESC || conn->_base.purpose == DIR_PURPOSE_FETCH_EXTRAINFO

http://%s

If-Modified-Since: %s

/tor/rendezvous/%s

%s %s%s HTTP/1.0

Host: %s%s%s

/tor/rendezvous2/%s

/tor/status-vote/current/consensus/%s.z

/tor/status-vote/next/%s.z

/tor/keys/%s

/tor/extra/%s

/tor/server/%s

/tor/status/%s

conn->_base.type == CONN_TYPE_DIR

parse_http_url

parse_http_response

write_http_status_line

HTTP/1.0 %d %s

write_http_response_header_impl

HTTP/1.0 200 OK

Date: %s

Content-Type: %s

Content-Encoding: %s

Expires: %s

X-Your-Address-Is: %s

Not supported.

conn->_base.state == DIR_CONN_STATE_CONNECTING

http_set_address_origin

/tor/keys/

/tor/robots.txt

/tor/keys/all

/tor/keys/authority

/tor/keys/fp/

/tor/keys/sk/

/tor/keys/fp-sk/

connection_dir_download_cert_failed

conn->_base.purpose == DIR_PURPOSE_FETCH_CERTIFICATE

conn->_base.purpose != DIR_PURPOSE_FETCH_EXTRAINFO

or_port || dir_port

CLOCK_SKEW SKEW=%ld SOURCE=DIRSERV:%s:%d

@downloaded-at %s

@source %s

%s%s%s

ACCEPTED_SERVER_DESCRIPTOR DIRAUTH=%s:%d

BAD_SERVER_DESCRIPTOR DIRAUTH=%s:%d REASON="%s"

nickname

0.2.1.30

0.2.2.1-alpha

0.2.2.21-alpha

dirserv_get_nickname_by_digest

published %s

recommended-software %s

router-status %s

dir-signing-key

%sdirectory-signature %s

r %s %s %s%s%s %s %d %d

s%s%s%s%s%s%s%s%s%s%s%s%s%s

w Bandwidth=%d

opt v %s

Measured=%d

tor_memeq(desc->cache_info.signed_descriptor_digest, rs->descriptor_digest, DIGEST_LEN)

0.1.1.16-rc-cvs

0.2.1.31

0.2.2.34

0.2.3.6-alpha

tor_version_parse("0.2.3.6-alpha", &first_good_later_guard_version)>=0

tor_version_parse("0.2.2.34", &first_good_0_2_2_guard_version)>=0

tor_version_parse("0.2.1.31", &first_good_0_2_1_guard_version)>=0

private_key

cert

client-versions %s

server-versions %s

dir-source %s %s %d

fingerprint %s

contact %s

dir-options%s%s%s%s

%sdir-signing-key

directory-signature %s

Key not recognized

@uploaded-at %s

conn->_base.state == DIR_CONN_STATE_SERVER_WRITING

vote-status %s

consensus-methods %s

valid-after %s

fresh-until %s

valid-until %s

voting-delay %d %d

%sknown-flags %s

dir-source %s %s %s %s %d %d

legacy-dir-key %s

private_signing_key

outp   cert->cache_info.signed_descriptor_len < endp

%s%s%s %s %s %s

consensus-digest %s

additional-digest %s %s %s

authority_cert_dup

vote->cert

onion-key

family %s

m %s sha256=%s

1234567890

network-status-version 3%s%s

known-flags %s

dir-source %s%s %s %s %s %d %d

vote-digest %s

consensus-method %d

Missing consensus bandwidth for router %s

vote->supported_methods

bandwidth-weights Wbd=%d Wbe=%d Wbg=%d Wbm=%d Wdb=%d Web=%d Wed=%d Wee=%d Weg=%d Wem=%d Wgb=%d Wgd=%d Wgg=%d Wgm=%d Wmb=%d Wmd=%d Wme=%d Wmg=%d Wmm=%d

Wbd=%d Wbe=%d Wbg=%d Wbm=%d Wdb=%d Web=%d Wed=%d Wee=%d Weg=%d Wem=%d Wgb=%d Wgd=%d Wgg=%d Wgm=%d Wmb=%d Wmd=%d Wme=%d Wmg=%d Wmm=%d

fast_memeq(lowest_id, rs->status.identity_digest,DIGEST_LEN)

fast_memeq(rs_out.identity_digest, vsr->status.identity_digest, DIGEST_LEN)

vsr->status.exitsummary

moria1 orport=9101 no-v2 v3ident=D586D18309DED4CD6D57C18FDB97EFA96D330566 128.31.0.39:9131 9695 DFC3 5FFE B861 329B 9F1A B04C 4639 7020 CE31

tor26 v1 orport=443 v3ident=14C131DFC5C6F93646BE72FA1401C02A8DF2E8B4 86.59.21.38:80 847B 1F85 0344 D787 6491 A548 92F9 0493 4E4E B85D

dizum orport=443 v3ident=E8A9C45EDE6D711294FADF8E7951F4DE6CA56B58 194.109.206.212:80 7EA6 EAD6 FD83 083C 538F 4403 8BBF A077 587D D755

Tonga orport=443 bridge no-v2 82.94.251.203:80 4A0C CD2D DC79 9508 3D73 F5D6 6710 0C8A 5831 F16D

turtles orport=9090 no-v2 v3ident=27B6B5996C426270A5C95488AA5BCEB6BCC86956 76.73.17.194:9030 F397 038A DC51 3361 35E7 B80B D99C A384 4360 292B

gabelmoo orport=443 no-v2 v3ident=ED03BB616EB2F60BEC80151114BB25CEF515B226 212.112.245.170:80 F204 4413 DAC2 E02E 3D6B CF47 35A1 9BCA 1DE9 7281

dannenberg orport=443 no-v2 v3ident=585769C78764D58426B8B52B6651A5A71137189A 193.23.244.244:80 7BE6 83E6 5D48 1413 21C5 ED92 F075 C553 64AC 7123

urras orport=80 no-v2 v3ident=80550987E1D626E3EBA5E5E75A458DE0626D088C 208.83.223.34:443 0AD3 FA88 4D18 F89E EA2D 89C0 1937 9E0E 7FD9 4417

maatuska orport=80 no-v2 v3ident=49015F787433103580E3B66A1707A00E60F2D15B 213.115.239.118:443 BD6A 8292 55CB 08E6 6FBE 7D37 4836 3586 E46B 3810

%s\wininet.dll

HttpOpenRequestA

HttpSendRequestA

InternetOpenUrlA

https://bridges.torproject.org

bridges.torproject.org

HTTPS

dlg_bypassbl.c

iplist.dat

%s.&log

%s=%d,"%s" %s

%s (PID: %d)

PID: %u

=%d,"%s"

%s.onion

%s.onion ( %s )

ShowOpenPorts

%s [exit(%s%s): %d.%d.%d.%d (%s)]

%s [exit(%s%s): %d.%d.%d.%d]%s

%s - %s

%s - %s exit

%s [exit(%s)]%s

%s-%s.lng

%u,%u,%u,%u,%u,%u,%u,%u

%s %s by Albu Cristian, 2009-2012

UnregisterPluginKey

GetProcessChainKey

GetChainKeyName

RegisterPluginKey

%s reject *:*

[%s%s] %d.%d.%d.%d - $

[%s%s] %d.%d.%d.%d (%s)

%d.%d.%d.%d:%d

-> %s

[Internal][%s] %s_%d - %s

[Exit][%s] %s_%d - %s

[%s] %s_%d - %s

[%s] Circuit_%d - %s

; [%s%s] %d.%d.%d.%d (

dlg_proxy_http.c

%s,%s

[X] %s

[E] %s

CtrlId: %u, reference.left: %ld, reference.top: %ld, reference.right: %ld, reference.bottom: %ld

NAMESERVER_STATUS NS=%s STATUS=DOWN ERR=%s

eventdns: %s

NAMESERVER_STATUS NS=%s STATUS=UP

.invalid

.test

!resolve->result.a.addr

!resolve->result.hostname

conn->_base.state == EXIT_CONN_STATE_RESOLVING

%s.tmp

%s*.*

%s-%s-%s

%s-%s

Invalid password.

cached-certs

cached-descriptors.new

keys-secret_onion_key

keys-secret_onion_key.old

keys-legacy_signing_key

keys-authority_signing_key

keys-legacy_certificate

keys-authority_certificate

keys-secret_id_key

%s--*.*

%s-%s-private_key

%s-%s-client_keys

%s-%s-hostname

-private_key

%s.bak

ntdll.dll

kernel32.dll

\??\%s

NtDeleteFile(): the file %s was deleted successfully

ForceDelete(): could not delete the file %s

ForceDelete(): the file %s was deleted successfully

%s\*.*

ForceDelete(): the directory %s was deleted successfully

%s\%s

Deleting %s

ForceDelete(): could not delete the directory %s

complete=%u,timeout=%u,running=%u

,min=%u,d1=%u,d2=%u,q1=%u,d3=%u,d4=%u,md=%u,d6=%u,d7=%u,q3=%u,d8=%u,d9=%u,max=%u

%s=%u

dirreq-stats-end %s (%d s)

dirreq-v3-ips %s

dirreq-v2-ips %s

dirreq-v3-reqs %s

dirreq-v2-reqs %s

dirreq-v3-resp ok=%u,not-enough-sigs=%u,unavailable=%u,not-found=%u,not-modified=%u,busy=%u

dirreq-v2-resp ok=%u,unavailable=%u,not-found=%u,not-modified=%u,busy=%u

dirreq-v3-direct-dl %s

dirreq-v2-direct-dl %s

dirreq-v3-tunneled-dl %s

dirreq-v2-tunneled-dl %s

BTimeStarted="%s" CountrySummary=%s

bridge-stats-end %s (%ld s)

bridge-ips %s

entry-stats-end %s (%u s)

entry-ips %s

\Macromedia\Flash Player\macromedia.com\support\flashplayer\sys

Software\Microsoft\Windows\CurrentVersion\Explorer\Shell Folders

[HKEY_CURRENT_USER\Software\Microsoft\MediaPlayer\Player\Settings]

undo.reg

{XX-X-X-X-XXX}

%s%s"

%s\Application Data

%s\AppData\LocalLow\Microsoft\Silverlight\is\*.*

%s\AppData\LocalLow\Microsoft\Silverlight\is\%s

%s\Microsoft\Silverlight\is\*.*

%s\Microsoft\Silverlight\is\%s

%s%s\*.*

%s%s\%s\*.*

%s%s\%s\%s

%s%s\%s

settings.sol

macromedia.com

%s%i%s

inetcpl.cpl

wininet.dll

FindFirstUrlCacheEntryA

FindNextUrlCacheEntryA

FindCloseUrlCache

DeleteUrlCacheEntry

index.dat

%s : %s [PID: %u]

%sInternet Explorer [inetcpl.cpl]

%s\Microsoft\Internet Explorer\DOMStore\*.*

%s\Microsoft\Internet Explorer\DOMStore\%s

%s\Microsoft\Windows\Cookies\*.*

%s\Microsoft\Windows\Cookies\%s

%s\Cookies\*.*

%s\Cookies\%s

%s\AppData\LocalLow\Microsoft\Internet Explorer\DOMStore\*.*

%s\AppData\LocalLow\Microsoft\Internet Explorer\DOMStore\%s

%sInternet Explorer

%sInternet Explorer [wininet.dll]

opera.dll

operaprefs_default.ini

profile\cookies4.dat

profile\icons\cache\cookies4.dat

%sOpera [Multi User]

%s\Opera\*.*

%s\Opera\%s\icons\cache\cookies4.dat

%s\Opera\%s\cookies4.dat

%s\Opera\%s\profile\cookies4.dat

%s\Opera\%s\pstorage

%sOpera [Portable]

%sOpera [opera.dll]

xul.dll

%s\Mozilla\Firefox\Profiles\*.*

%s\Mozilla\Firefox\Profiles\%s\cookies.sqlite

%s\Mozilla\Firefox\Profiles\%s\sessionstore.js

%sFirefox

%s%i.

%sFirefox [xul.dll]

%s\Google\Chrome\User Data\Default\Cookies

%s\Google\Chrome\User Data\Default\Extension Cookies

%s\Google\Chrome\User Data\Default\Local Storage\*.*

%s\Google\Chrome\User Data\Default\Local Storage\%s

%sChrome

CFHTTPCookieStorageDeleteAllCookies

_CFHTTPCookieStorageGetDefault

%s\Apple Computer\Safari\LocalStorage\*.*

%s\Apple Computer\Safari\LocalStorage\%s

%s\Apple Computer\Safari\Cookies\Cookies.plist

%sSafari

%sSafari [CFNetwork.dll]

chrome.dll

cfnetwork.dll

CFNetwork.dll

Real port(s)

Virtual port(s)

The process with PID %d was released successfully

There was an error while trying to release the process with PID %d.

AdvOR.dll was not unloaded.

Added to favorites: %s

Added to banlist: %s

--exec [file]

Bypass ISP filtering

HTTP headers

Firewall restrictions ([reject] range|*:port|*), each rule on a new line:

Start with Windows

Control port:

Require authentication with password hash(es):

Disallow non TCP sockets

Proxy port:

Banned ports (port1,port2,...):

Ports for services that have long-running connections:

Do not use the public key step for the entry node when creating circuits (faster)

Banned routers ([X] nicknames or hashes), each router on a new line:

Favorite routers ([E|X] nicknames or hashes), each router on a new line:

Port:

Nickname:

Accept only these addresses (range:port):

Banned IPs / ports (range:port)

Also, adjust reported local time to a random router's local time

Real port(s):

Virtual port(s):

Save to %s

Circuit length: %d routers

Cleaned freelist for %d-byte chunks: original length %d, kept %d, dropped %d.

%I64u bytes in %d %d-byte chunks [%I64u misses; %I64u frees; %I64u hits]

Encountered eof on fd %d

Read %ld bytes. %d on inbuf.

flushed %d bytes, %d ready to flush, %d remain.

headerlen %d, bodylen %d.

headerlen %d larger than %d. Failing.

bodylen %d larger than %d. Failing.

Got a contentlen of %d.

bodylen reduced to %d.

socks5: command %d not recognized. Rejecting.

socks5 IP takes %d bytes, which doesn't fit in %d. Rejecting.

Your application (using socks5 to port %d) is giving Tor only an IP address. Applications that do DNS resolves themselves may leak information. Consider using Socks4A (e.g. via privoxy or socat) instead. For more information, please see http://wiki.torproject.org/noreply/TheOnionRouter/TorFAQ#SOCKSAndDNS.%s

socks5 hostname is %d bytes, which doesn't fit in %d. Rejecting.

Your application (using socks5 to port %d) gave Tor a malformed hostname: %s. Rejecting the connection.

Your application (using socks5 to port %d) gave Tor a hostname, which means Tor will do the DNS resolve for you. This is good.

socks5: unsupported address type %d. Rejecting.

socks4: command %d not recognized. Rejecting.

socks4: Port or DestIP is zero. Rejecting.

socks4: destip not in form 0.0.0.x.

socks4 addr (%d bytes) too long. Rejecting.

socks4: successfully read destip (%s)

Your application (using socks4 to port %d) is giving Tor only an IP address. Applications that do DNS resolves themselves may leak information. Consider using Socks4A (e.g. via privoxy or socat) instead. For more information, please see http://wiki.torproject.org/noreply/TheOnionRouter/TorFAQ#SOCKSAndDNS.%s

Your application (using socks4a to port %d) gave Tor a hostname, which means Tor will do the DNS resolve for you. This is good.

Your application (using socks4 to port %d) gave Tor a malformed hostname: %s. Rejecting the connection.

Attempt to bypass proxy settings with address %s:%u .

%s: Attempt to bypass proxy settings with address %s:%u .

Not a proxy request: %s

Socks version %d not recognized. (Tor is not an http proxy.) - %s

Chosen circID %u.

First hop: finished sending %s cell to '%s'

Looking for firsthop '%s:%u'

Next router is %s: %s

or_conn to %s/%s, status=%d

Now checking whether ORPort %s:%d%s %s reachable... (this may take up to %d minutes -- look for log messages indicating success)

Your system clock just jumped %d seconds %s; assuming established circuits no longer work.

Wrong length %d on extend cell. Closing circuit.

Client asked me to extend to zero destination port or addr.

Next router (%s:%d): %s

n_conn is %s:%u

Finished building %scircuit hop:

Marking stream %d for close because of truncate.

Chosen route length %d (%d/%d routers suitable).

Not enough acceptable routers (%d). Discarding this circuit.

Not enough routers: cutting routelen from %d to %d.

Choosing exit node; %d connections are pending

Skipping node %s -- it's me.

Skipping node %s (index %d) -- invalid router.

Skipping node %s (index %d) -- it rejects all.

%s is supported. n_supported[%d] now %d.

%s (index %d) would reject this stream.

%s is new best supported option so far.

Found %d servers that might support %d/%d pending connections.

We couldn't find any live%s%s routers; falling back to list of all routers.

Try %d: '%s' is a possibility.

Chose exit server '%s'

Unhandled purpose %d

Requested exit node '%s' is in ExcludeNodes, or ExcludeExitNodes, using anyway.

Using requested exit node '%s'

Couldn't extend circuit to new point '%s'.

Contemplating whether router %d (%s) is a new option.

Nope, the directory says %d is not running.

Nope, the directory says %d is not valid.

I like %d. num_acceptable_routers now %d.

Path is complete: %d steps long

Path is %d long; we want %d

Failed to find node for hop %d of our path. Discarding this circuit.

Chose router %s for hop %d (exit is %s)

Entry guard %s (%s) is %s: marking as unusable.

Entry guard %s (%s) is no longer unusable: marking as ok.

Chose '%s' as new entry guard.

Entry guard '%s' (%s) %s. (Version=%s.) Replacing it.

Entry guard '%s' (%s) has been down or unlisted since %s local time; removing.

Summary: Entry '%s' is %s, %s%s%s, and %s.

(%d/%d entry guards are usable/new)

Entry guard '%s' (%s) is now reachable again. Good.

Connection to never-contacted entry guard '%s' (%s) failed. Removing from the list. %d/%d entry guards usable/new.

Unable to connect to entry guard '%s' (%s). Marking as unreachable.

Failed to connect to unreachable entry guard '%s' (%s). It has been unreachable since %s.

Connected to new entry guard '%s' (%s). Marking earlier entry guards up. %d/%d entry guards usable/new.

Adding configured EntryNodes '%s'.

EntryGuardAddedBy line %s does not begin with hex digest

Unexpected key %s

Can't read time %s in EntryGuardAddedBy

ask_bridge_directly=%d (%d, %d, %d)

Bridge at '%s:%d' isn't reachable by our firewall policy. %s.

Fetching bridge info '%s' from bridge authority.

new bridge descriptor '%s' (%s)

found one: %s

any_known %d, any_running %d

or_conn to %s, %d pending circs

Unknown circuit state %d

Conn %d has %s circuit: circID %d (other side %d), state %d (%s), born %d:

Hunting for a circ to cannibalize: purpose %d, uptime %d, capacity %d, internal %d

Duplicate call to circuit_mark_for_close at %s:%d (first at %s:%d)

Specified 'at-origin' non-reason for ending circuit, but circuit was not at origin. (called %s:%d, purpose=%d)

Reason %d out of range at %s:%d

Failed intro circ %s to %s (awaiting ack). Removing from descriptor.

Unexpected state %d

Considering %sopen purp %d to %s (circid %d).(clean).

Considering %sopen purp %d to %s (circid %d). %d secs since dirty.

Abandoning circ %s:%d:%d (state %d:%s, purpose %d)

Abandoning circ %d (state %d:%s, purpose %d)

Port %d is already being handled; removing.

Port %d is not handled.

Have %d clean circs (%d internal), need another exit circ.

Have %d clean circs (%d internal), need another internal circ for my hidden service.

Have %d clean circs (%d uptime-internal, %d internal), need another hidserv circ.

Closing n_circ_id %d (dirty %d secs ago, purp %d)

Closing circuit that has been unused for %d seconds.

Our testing circuit (to see if your ORPort is reachable) has failed. I'll try again later.

Our circuit failed to get a response from the first hop (%s:%d). I'm going to try to rotate to a better connection.

Couldn't connect to Alice's chosen rend point %s (%s hop failed).

Cannibalizing circ '%s' for purpose %d

unexpected purpose %d when cannibalizing a circ.

%d failures so far, not trying.

n_circuit_failures now %d.

No Tor server allows exit to %s:%d. Rejecting.

Requested exit point '%s' would refuse request. %s.

No intro points for '%s': refetching service descriptor.

Chose '%s' as intro point for '%s'.

considering %d, %s

Broken address %s on tunnel conn. Closing.

Requested exit point '%s' is not known. %s.

No safe circuit (purpose %d) ready for edge connection; delaying.

attaching new conn to circ. n_circ_id %d.

Registering new tracked exit host %s.

Tried for %d seconds to get a connection to %s:%d. Giving up.

Attaching apconn to circ %d (stream %d sec old).

rend joined circ %d already here. attaching. (stream %d sec old)

pending-join circ %d already here, with intro ack. Stalling. (stream %d sec old)

Intro circ %d present and awaiting ack (rend %d). Stalling. (stream %d sec old)

ready rend circ %d already here (no intro-ack yet on intro %d). (stream %d sec old)

found open intro circ %d (rend %d); sending introduction. (stream %d sec old)

Intro (%d) and rend (%d) circs are not both ready. Stalling conn. (%d sec old)

At end of second: %d creates (%d ms), %d createds (%d ms), %d relays (%d ms), %d destroys (%d ms)

Cell of unknown type (%d) received. Dropping.

At end of second: %d versions (%d ms), %d cert (%d ms)

Variable-length cell of unknown type (%d) received.

Received create cell (type %d) from %s:%d, but we're a client. Sending back a destroy.

Received create cell with unexpected circ_id %d. Closing.

Received CREATE cell (circID %d) for known circ. Dropping (age %d).

Details: nickname "%s", platform %s.

Failed to generate key material. Closing.

(circID %d) unknown circ (probably got a destroy earlier). Dropping.

unknown circuit %d on connection from %s:%d. Dropping.

Received an inbound RELAY_EARLY cell on circuit %d from %s:%d. Closing circuit.

Received too many RELAY_EARLY cells on circ %d from %s:%d. Closing circuit.

circuit_receive_relay_cell (%s) failed. Closing.

Received for circID %d.

Received a VERSIONS cell on a connection with its version already set to %d; dropping

Negotiated version %d with %s:%d; sending NETINFO.

Received a NETINFO cell on %s connection; dropping.

Received NETINFO cell with skewed time from server at %s:%d. It seems that our clock is %s by %s, or that theirs is %s. Tor requires an accurate clock to work: please check your time and date settings.

Got good NETINFO cell from %s:%d; OR connection is now open, using protocol version %d

Closing old %s on %s:%d

Closing partially-constructed listener %s on %s:%d

Error loading rendezvous service keys

Error initializing keys; exiting

Choosing default nickname '%s'

DirPortFrontPage file '%s' not found. Continuing anyway.

The configuration option '%s' is deprecated; use '%s' instead.

Commandline: parsed keyword '%s', value '%s'

The abbreviation '%s' is deprecated. Please use '%s' instead

Skipping obsolete configuration option '%s'

Found unrecognized option '%s'; saving it.

Linelist option '%s' has no value. Skipping.

Unknown option '%s'. Failing.

You asked me for the value of an obsolete config option '%s'.

Can't return context-sensitive '%s' on its own

Unknown type %d for known key '%s'

Failed to assign default: %s

Guessed local host name as '%s'

Could not resolve local Address '%s'. Failing.

Could not resolve guessed local hostname '%s'. Trying something else.

Learned IP address '%s' for local interface. Using that.

Guessed local hostname '%s' resolves to a private IP address (%s). Trying something else.

Interface IP address '%s' is a private address too. Ignoring.

Address '%s' resolves to private IP address '%s'. Tor servers that use the default DirServers must have public IP addresses.

Address '%s' resolves to private IP address '%s'. Please set the Address config option to be the IP address you want to use.

Resolved Address to '%s'.

Your IP address seems to have changed to %s. Updating.

Config_get_assigned_option() generated something we couldn't config_assign(): %s

Internal error writing option value %s

You specified a public address '%s' for a %s. Other people on the Internet might find your computer and use it as an open %s. Please don't allow this unless you have a good reason.

SocksPort, TransPort, NatdPort, DNSPort, and ORPort are all undefined, and there aren't any hidden services configured. Tor will still run, but probably won't do anything.

Converting FascistFirewall and FirewallPorts config options to new format: "ReachableAddresses %s"

RendPostPeriod option is too short; raising to %d seconds.

RendPostPeriod is too large; clipping to %ds.

CircuitBuildTimeout option is too short; raising to %d seconds.

MaxCircuitDirtiness option is too short; raising to %d seconds.

You have a ControlListenAddress set to accept unauthenticated connections from a non-local address. This means that programs not running on your computer can reconfigure your Tor, without even having to guess a password. That's so bad that I'm closing your ControlPort for you. If you need to control your Tor remotely, try enabling authentication and using a tool like stunnel or ssh to encrypt remote access.

You have a ControlListenAddress set to accept connections from a non-local address. This means that programs not running on your computer can reconfigure your Tor. That's pretty bad, since the controller protocol isn't encrypted! Maybe you should just listen on 127.0.0.1 and use a tool like stunnel or ssh to encrypt remote connections to your control port.

ControlPort is open, but no authentication method has been configured. This means that any program on your computer can reconfigure your Tor. That's bad! You should upgrade your Tor controller as soon as possible.

Opening config file "%s"

Configuration file "%s" not present, using reasonable defaults.

Unable to open configuration file "%s".

Unparseable bandwidth history state: %s

Skipping invalid argument '%s' in MapAddress

MapAddress '%s' has too few arguments. Ignoring.

Error parsing Bridge address '%s'

Missing port in Bridge address '%s'

Key digest for Bridge is wrong length.

Unable to decode Bridge key digest.

Bridge at %s:%d (%s)

no key listed

Invalid orport '%s' on DirServer line.

Bad v3 identity digest '%s' on DirServer line

Unrecognized flag '%s' on DirServer line

Error parsing DirServer address '%s'

Missing port in DirServer address '%s'

Key digest for DirServer is wrong length %d.

Unable to decode DirServer key digest.

Trusted %d dirserver at %s:%d (%s)

Config file "%s" is not a file? Failing.

Renaming old configuration file to "%s"

Couldn't rename configuration file "%s" to "%s": %s

Unknown unit '%s'.

Interval '%s' is too long

We were compiled with headers from version %s of Libevent, but we're using a Libevent library that says it's version %s.

This will almost certainly make Tor crash.

It's a little hard to tell, but you seem to have Libevent 1.4.0-beta header files, whereas you have linked against Libevent %s. This will probably make Tor crash.

It's a little hard to tell, but you seem to have Libevent header file from 1.3e or earlier, whereas you have linked against Libevent %s. This will probably make Tor crash.

Initialized libevent version %s using method %s. Good.

Libevent version %s often crashes when running a Tor server with %s. Please use the latest version of libevent (1.3b or later)

There are serious bugs in using %s with libevent %s. Please use the latest version of libevent.

There are minor bugs in using %s with libevent %s. You may want to use the latest version of libevent.

libevent %s can be very slow with %s. When running a server, please use the latest version of libevent.

Obsolete file %s hasn't been modified since %s. Removing it.

You have requested constrained socket buffers while also serving directory entries via DirPort. It is strongly suggested that you disable serving directory requests when system TCP buffer resources are scarce.

ORPort must be defined if ORListenAddress is defined.

DirPort must be defined if DirListenAddress is defined.

DNSPort must be defined if DNSListenAddress is defined.

ControlPort must be defined if ControlListenAddress is defined.

TransPort must be defined if TransListenAddress is defined.

NatdPort must be defined if NatdListenAddress is defined.

TransPort and TransListenAddress are disabled in this build.

IPs or countries are not yet supported in EntryNodes.

Running as authoritative directory, but no DirPort set.

Running as authoritative directory, but no ORPort set.

HttpProxy failed to parse or resolve. Please fix.

HttpProxyAuthenticator is too long (>= 512 chars).

HttpsProxy failed to parse or resolve. Please fix.

HttpsProxyAuthenticator is too long (>= 512 chars).

Bad HashedControlPassword: wrong length or bad encoding

Bad HashedControlSessionPassword: wrong length or bad encoding

ConstrainedSockSize is invalid. Must be a value between %d and %d in 1024 byte increments.

Int keyword '%s %s' is malformed or out of bounds.

Interval '%s %s' is malformed or out of bounds.

Value '%s %s' is malformed or out of bounds.

Boolean '%s %s' expects 0 or 1.

Invalid time '%s' for keyword '%s'

Invalid exit list '%s' for option '%s'

Port '%s' out of range in %s

You may not provide a value for virtual option '%s'

Nickname '%s' is wrong length or contains illegal characters.

BandwidthRate is set to %d bytes/second. For servers, it must be at least %d.

MaxAdvertisedBandwidth is set to %d bytes/second. For servers, it must be at least %d.

RelayBandwidthRate is set to %d bytes/second. For servers, it must be at least %d.

Invalid nickname '%s' in %s line

Failed to parse/validate config: %s

unknown connection type %d

unknown connection state %d (type %d)

Error removing read event for %d

Error removing write event for %d

Freeing linked %s connection [%s] with %d bytes on inbuf, %d on outbuf.

Could not unlink %s: %s

closing fd %d.

(Harmless.) Edge connection (marked at %s:%d) hasn't sent end yet?

Closing stream (marked at %s:%d) without sending back a socks reply.

Closing stream (marked at %s:%d) without having set end_reason.

Closing stream (marked at %s:%d) without having replied to DNS request.

fd %d, type %s, state %s, %d bytes on outbuf.

Duplicate call to connection_mark_for_close at %s:%d (first at %s:%d)

Giving up on marked_for_close conn that's been flushing for 15s (fd %d, type %s, state %s).

Error parsing/resolving ListenAddress %s

Unix domain sockets not supported, yet we tried to create one.

Failing because we have %d connections already. Please raise your ulimit -n.%s

Opening %s on %s:%d

Could not bind to %s:%u: %s%s

Could not listen on %s:%u: %s

Opening %s on %s

Socket creation failed: %s.

Bind to %s failed: %s.

Could not listen on %s: %s

Got unexpected address family %d.

%s listening on port %u.

Length of address not as expected: %d vs %d

Address for new connection has address/port equal to zero.

A listener connection returned a socket with a mismatched family. %s for addr_family %d gave us a socket with address family %d. Dropping.

accept() failed: %s. Closing listener.

Connection accepted on socket %d (child of fd %d).

getsockname() for new connection failed: %s

Denying socks connection from untrusted address %s.

Denying dir connection from address %s.

Rejecting request for banned address %s:%u .

Connection request for %s:%u .

Resolve request for %s [:%u] .

Resolve request for %s .

Error creating network socket: %s

Outbound bind address '%s' didn't parse. Ignoring.

Error binding network socket: %s

Connecting to %s:%u.

connect() to %s:%u failed: %s

Connection to %s:%u %s (sock %d).

Closing no-longer-configured %s on %s:%d

Already have %s on %s:%d

Value out of range. num_read=%lu, num_written=%lu, connection type=%s, state=%s

waking up conn (fd %d) for read

waking up conn (fd %d) for write

%d: starting, inbuf_datalen %ld (%d pending in tls object). at_most %ld.

TLS connection closed %son read. Closing. (Nickname %s, address %s)

tls error [%s]. breaking (nickname %s, address %s).

After TLS read of %d: %ld read, %ld written

Moved %d bytes on an internal link!

getsockopt() syscall failed?! Please report to tor-ops.

in-progress connect failed. Removing. (%s)

tls error [%s]. breaking connection.

After TLS write of %d: %ld read, %ld written

write_to_buf failed. Closing circuit (fd %d).

write_to_buf failed. Closing connection (fd %d).

unhandled error on write for conn (type %d, fd %d); removing

getsockname() to check for address change failed: %s

Our IP address has changed. Rotating keys...

setsockopt() to constrain send buffer to %d bytes failed: %s

setsockopt() to constrain recv buffer to %d bytes failed: %s

got unexpected conn type %d.

In buffers for %d connections: %I64u used/%I64u allocated

For %d %s connections: %I64u used/%I64u allocated

stream (marked at %s:%d) sending two socks replies?

conn (fd %d) reached eof. Closing.

data from edge while in '%s' state. Leaving it on buffer.

Got unexpected state %d. Closing.

CircID %d: At an edge. Marking connection for close.

(Harmless.) Calling connection_edge_end (reason %d) on an already ended stream?

called on conn that's already marked for close at %s:%d.

Sending end on conn (fd %d).

No circ to send end on conn (fd %d).

Called in unexpected state %d.

Exit connection to %s:%u (%s) established.

Tried for %d seconds to get a connection to %s:%d. Giving up. (%s)

Conn is waiting (address %s), but lost its circ.

Rend stream is %d seconds late. Giving up on address '%s.onion'.

We tried for %d seconds to connect to '%s' using exit '%s'. Retrying on a new circuit.

Closing onehop stream to '%s/%s' because the OR conn just failed.

Giving up on enclave exit '%s' for destination %s.

Clearing TrackHostExists mappings for exit '%s'

Addressmap: rewriting %s to %s

Loop detected: we've rewritten %s 16 times! Using it as-is.

Rewrote reverse lookup %s -> %s

Temporary addressmap ('%s' to '%s') not performed, since it's already mapped to '%s'

Addressmap: (re)mapped '%s' to '%s'

Address %s now has %d resolve failures.

%d addrs available

Called with unsupported address type (%d)

Internal confusion: I thought that '%s' was mapped to by '%s', but '%s' really maps to '%s'. This is a harmless bug.

Registering map from %s to %s

Map from %s to %s okay.

Application request to port %d: this port is commonly used for unencrypted protocols. Please make sure you don't send anything you would mind the rest of the Internet reading!%s

Port %d listed in RejectPlaintextPorts. Closing.

Client asked for %s:%d

Automapping %s to %s

Missing mapping for virtual address '%s'. Refusing.

Invalid hostname %s; rejecting

Malformed exit address '%s.exit'. Refusing.

Unrecognized server in exit address '%s.exit'. Refusing.

Destination '%s' seems to be an invalid hostname. Failing.

Application asked to connect to port 0. Refusing.

Redirecting address %s to exit at enclave router %s

Attachstream to a circuit is not supported for .onion addresses currently. Failing.

Got a hidden service request for ID '%s'

Invalid service name '%s'

Unknown descriptor %s. Fetching.

Stale descriptor %s. Refetching.

getsockopt() failed: %s

getsockname() to determine transocks destination failed: %s

getsockname() gave an unexpected address family (%d)

Natd handshake was ill-formed; closing. The client said: %s

Natd handshake failed; port %s is ill-formed or out of range.

Sending relay cell to begin stream %d.

Address/port sent, ap socket %d, n_circ_id %d

Rejecting ill-formed reverse lookup of %s

Couldn't generate reverse lookup hostname of %s

Address sent for resolve, ap socket %d, n_circ_id %d

Making internal %s tunnel to %s:%d ...

Unable to parse addr:port in relay begin cell. Closing.

Missing port in relay begin cell. Closing.

Got an unexpected command %d

Didn't find rendezvous service (port %d)

Finished assigning addr/port

%s:%d failed exit policy. Closing.

Didn't find connection '%s' on identity map when trying to remove it.

Your https proxy sent back an oversized response. Closing.

https proxy response not all here yet. Waiting.

Unparseable headers from proxy (connecting to '%s'). Closing.

HTTPS connect to '%s' successful! (200 %s) Starting TLS.

The https proxy sent back an unexpected status code %d (%s). Closing.

Called connection_or_finished_flushing() in unexpected state %d.

OR connect() to router at %s:%u finished.

Encoding https authenticator failed

Marking OR conn to %s:%d as too old for new circuits (fd %d, %d secs old).

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). It is not canonical, and we have another connection to that OR that is.

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). We have a better canonical one (fd %d; %d secs old).

Marking OR conn to %s:%d as too old for new circuits: (fd %d, %d secs old). We have a better one (fd %d; %d secs old).

starting TLS handshake on fd %d

Tried connecting to router at %s:%d, but it didn't send a cert! Closing.

Got incoming connection with no certificate. That's ok.

Tried connecting to router at %s:%d: It has a cert but it's invalid. Closing.

Incoming connection gave us an invalid cert chain; ignoring.

The certificate seems to be valid on %s connection with %s:%d

Connected to router %s at %s:%d without knowing its key. Hoping for the best.

Tried connecting to router at %s:%d, but identity key was not as expected: wanted %s but got %s.

tls handshake with %s done. verifying.

%d: starting, inbuf_datalen %d (%d pending in tls object).

Sending destroy (circID %d).

Controller gave us config lines that didn't validate: %s

Controller gave us config file that didn't validate: %s

Got authentication cookie with wrong length (%d)

Couldn't decode HashedControlPassword: invalid base16

Bad password or authentication cookie on controller.

Authenticated control connection (%d)

Unable to allocate address for '%s' in MapAddress msg

Skipping MapAddress '%s': wrong number of items.

getinfo '%s': %s

Asked for stream in unknown state %d

Controller used obsolete addr-mappings/ GETINFO key; use address-mappings/ instead.

%s is deprecated; it no longer gives useful information

Skipping unknown option %s

Unrecognized status code %d

Unrecognized status type %d

Unrecognized status severity %d

Error writing authentication cookie to %s.

Bootstrapped %d%%: %s.

Problem bootstrapping. Stuck at %d%%: %s. (%s; %s; count %d; recommendation %s)

Loading authority key certs

...and it left a circuit queued; abandoning circ.

decoding onionskin failed. (Old key or bad software.) Closing.

CPU worker exiting because Tor process closed connection (either rotated keys or died).

CPU worker exiting because of error on connection to Tor process. (Error on %d was %s)

Couldn't construct socketpair for cpuworker: %s

Called with unknown purpose %d

authority cert fetch

Uploading an extrainfo too (length %d)

Publishing server descriptor to directory authorities of type '%s', but no authorities of that type listed!

Unexpected purpose %d

No router found for %s; falling back to dirserver list.

While fetching directory info, no running dirservers known. Will try again later. (purpose %d)

Not sending anonymized request to directory '%s'; we don't have its router descriptor.

Giving up on directory server at '%s'; retrying

Giving up downloading detached signatures from '%s'

Giving up downloading votes from '%s'

anonymized %d, use_begindir %d. Initiating %s

Encoding HTTP authenticator failed

Downloading consensus from %s using %s

Squid does not like URLs longer than 4095 bytes, and this one is %d bytes long: %s%s

Skipping over 'http[s]://hostname' string

Ignoring unrecognized or internal IP %s

Failed to parse header %s

Unrecognized content encoding: %s. Trying to deal.

'fetch' response too large (server '%s:%d'). Closing.

Unparseable headers (server '%s:%d'). Closing.

Received response from directory server '%s:%d': %d %s

Received directory with skewed time (server '%s:%d'): It seems that our clock is %s by %s, or that theirs is %s. Tor requires an accurate clock to work: please check your time, timezone, and date settings.

Received http status code %d (%s) from server '%s:%d'. I'll try again soon.

HTTP body from server '%s:%d' was labeled %s, but it seems to be %s.%s

Unable to decompress HTTP body (server '%s:%d').

Received networkstatus objects (size %d) from server '%s:%d'

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status/%s". I'll try again soon.

Received http status code %d (%s) from server '%s:%d' while fetching consensus directory.

Received consensus directory (size %d) from server '%s:%d'

Unable to load consensus directory downloaded from server '%s:%d'. I'll try again soon.

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/keys/%s".

Received authority certificates (size %d) from server '%s:%d'

Unable to parse fetched certificates

Successfully loaded certificates from fetch.

Got votes (size %d) from server %s:%d

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status-vote/next/%s.z".

Error adding retrieved vote: %s

Added vote(s) successfully [msg: %s]

Got detached signatures (size %d) from server %s:%d

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/status-vote/consensus-signatures.z".

Problem adding detached signatures from %s:%d: %s

Received %s (size %d) from server '%s:%d'

Received http status code %d (%s) from server '%s:%d' while fetching "/tor/server/%s". I'll try again soon.

Received %d/%d %s requested from %s:%d

Authority '%s' declined our descriptor (not new)

http status 400 (%s) response from dirserver '%s:%d'. Please correct.

HTTP status %d (%s) reason unexpected while uploading descriptor to server '%s:%d').

Uploaded a vote to dirserver %s:%d

http status 400 (%s) response after uploading vote to dirserver '%s:%d'. Please correct.

http status %d (%s) reason unexpected while uploading vote to server '%s:%d').

Uploaded signature(s) to dirserver %s:%d

http status 400 (%s) response after uploading signatures to dirserver '%s:%d'. Please correct.

http status %d (%s) reason unexpected while uploading signatures to server '%s:%d').

Received rendezvous descriptor (size %d, status %d (%s))

http status 400 (%s). Dirserver didn't like our rendezvous query?

http status %d (%s) response unexpected while fetching hidden service descriptor (server '%s:%d').

Fetching v2 rendezvous descriptor failed: http status 400 (%s). Dirserver didn't like our v2 rendezvous query? Retrying at another directory.

Fetching v2 rendezvous descriptor failed: HTTP status %d (%s) response unexpected while fetching v2 hidden service descriptor (server '%s:%d'). Retrying at another directory.

Uploaded rendezvous descriptor (status %d (%s))

Uploading rendezvous descriptor: finished with status 200 (%s)

http status 400 (%s) response from dirserver '%s:%d'. Malformed rendezvous descriptor?

http status %d (%s) response unexpected (server '%s:%d').

conn reached eof, not reading. [state=%d] Closing.

Failed to decode requested authority digest %s.

rewritten url as '%s'.

Dumping %sdirectory to client.

Got a v2 rendezvous descriptor request for ID '%s'

Rejected v2 rend descriptor (length %d) from %s since we're not currently a hidden service directory.

Rejected v2 rend descriptor (length %d) from %s.

Problematic router descriptor or extra-info from %s ("%s").

Rejected router descriptor or extra-info from %s ("%s").

Rejected rend descriptor (length %d) from %s.

Unable to store signatures posted by %s: %s

Invalid input from address '%s'. Closing.

Got headers %s with unknown command. Closing.

called in unexpected state %d.

Dir connection to router %s:%u established.

Called with bad fingerprint in list: %s

Malformed fingerprint in list: %s

Skipping digest pair %s with non-standard length.

Skipping digest pair %s with missing dash.

Skipping non-decodable digest pair %s

Skipping digest %s with non-standard length.

Skipping non-decodable digest %s

%s failed %d time(s); I'll try again immediately.

%s failed %d time(s); I'll try again in %d seconds.

%s failed %d time(s); Giving up for a while.

%s: Network error

%s: Error downloading network status documents

%s: Error downloading router descriptors

%s: Error downloading certificates

%s: Sending request ...

Consensus URL: %s

%s: Downloading %s

%s: EOF

%s: Connection established

Couldn't decode fingerprint "%s"

Tried to add a mapping for reserved nickname %s

Reloading approved fingerprints from "%s"...

Cannot open fingerprint file '%s'. Failing.

Cannot open fingerprint file '%s'. That's ok.

Nickname '%s' too long in fingerprint file. Skipping.

Invalid nickname '%s' in fingerprint file. Skipping.

Invalid fingerprint (nickname '%s', fingerprint %s). Skipping.

Authorizing nickname '%s' would break many clients; skipping.

Authorizing nickname '%s' is not allowed; skipping.

Duplicate nickname '%s'.

%d fingerprints, %d digests known.

Good fingerprint for '%s'

Mismatched fingerprint for '%s'. ContactInfo '%s', platform '%s'.)

Marking '%s' as bad directory because of address '%s'

Marking '%s' as bad exit because of address '%s'

Rejecting '%s' because of address '%s'

Not marking '%s' valid because of address '%s'

Router '%s' published non-IP address '%s'. Refusing.

Router '%s' published internal IP address '%s'. Refusing.

Publication time for nickname '%s' is too far (%d minutes) in the future; possible clock skew. Not adding (%s)

Publication time for router with nickname '%s' is too far (%d minutes) in the past. Not adding (%s)

Router with nickname '%s' has invalid address '%s'. Not adding (%s).

Somebody attempted to publish a router descriptor '%s' (source: %s) with size %d. Either this is an attack, or the MAX_DESCRIPTOR_UPLOAD_SIZE (%d) constant is too low.

Not replacing descriptor from '%s' (source: %s); differences are cosmetic.

Did not add descriptor from '%s' (source: %s): %s.

Added descriptor from '%s' (source: %s): %s.

Somebody attempted to publish an extrainfo with size %d. Either this is an attack, or the MAX_EXTRAINFO_UPLOAD_SIZE (%d) constant is too low.

Router '%s' is now rejected: %s

Router '%s' is now %s.

write identity_pkey to string failed!

Removing too-old untrusted networkstatus in %s

Couldn't generate %s?

The %s is still clean; reusing.

New directory (size %d) has been built.

New directory (size %d):

Cutoffs: For Stable, %lu sec uptime, %lu sec MTBF. For Fast: %lu bytes/sec. For Guard: WFU %.03lf%%, time-known %lu sec, and bandwidth %lu or %lu bytes/sec. %s enough stability data.

Cannot get any descriptor for %s (wanted descriptor %s).

descriptor digest in routerlist does not match the one in routerstatus: %s vs %s (router %s)

Error computing signing key digest

Error computing identity key digest

Choosing valid-after time in vote as %s: consensus_set=%d, last_interval=%d

Writing public key to string failed.

Unable to get fingerprint for signing key

Generated a networkstatus %s we couldn't parse: <<%s>>

Don't know about any network status with fingerprint '%s'

Found router %s to be reachable at %s:%d. Yay.

Testing reachability of %s at %s:%u.

Generating consensus using method %d.

The other authorities will use consensus method %d, which I don't support. Maybe I should upgrade!

Conflict on naming for router: %s vs %s

The voters disagreed on the exit policy summary for router %s with descriptor %s. This really shouldn't have happened.

Not one of the voters that made us select descriptor %s for router %s had an exit policy summary

Wow, not one of the voters had an exit policy summary for %s. Wow.

Looking at signature from %s

We do not know any voter with ID %s

We already have a good signature from %s

Adding signature from %s

Not adding signature from %s

Choosing expected valid-after time as %s: consensus_set=%d, interval=%d

Scheduling voting. Known authority IDs are %s. Mine is %s.

Didn't find key/certificate to generate v3 vote

Can't generate v3 vote with expired certificate

Couldn't store my own vote! (I told myself, '%s'.)

We're missing votes from %d authorities. Asking every other authority for a copy.

Couldn't parse vote: length was %d

Got a vote from an authority (nickname %s, address %s) with authority key ID %s. This key ID is not recognized. Known v3 key IDs are: %s

We added a cert, but still couldn't find it.

Rejecting vote from %s with valid-after time of %s; we were expecting %s

We don't have enough votes to generate a consensus: %d of %d

Can't generate consensus without a certificate.

Could not add queued signature to new consensus: %s

Added %d pending signatures while building consensus.

Have %d signatures for adding to consensus.

Added %d signatures to consensus.

Got a signature from %s. Adding it to the pending consensus.

Got a signature from %s. Queuing it for the next consensus.

Not enough info to publish pending %s consensus

Error publishing %s consensus

Published %s consensus

This version of AdvOR requires AdvOR.dll version 0.1.0.7 or higher.

Error loading %s. Some features, like "Intercept" will be unavailable.

Advanced Onion Router v%s

Address: 127.0.0.1

Port: %d

127.0.0.1:%d

http://www.te-home.net/?do=work&id=advor

http://sourceforge.net/projects/advtor/files/

http://www.softpedia.com/get/Internet/Servers/WEB-Servers/Advanced-TOR.shtml

For feature requests and bug reports use one of the following forums:

http://www.te-home.net/?do=forum&id=advor

http://sourceforge.net/p/advtor/discussion/

Added to AddressMap: %s

Removed from AddressMap: %s

No exit node is currently in use. Use "Track exit for %s" option to associate a temporary exit node for %s .

The entry "%s" was not found in AddressMap

Expiring a dns resolve %s that's still pending. Forgot to cull it? DNS resolve didn't tell us about the timeout?

Forgetting old cached resolve (address %s, expires %lu)

The expired resolve we purged didn't match any in the cache. Tried to purge %s (%p); instead got %s (%p).

Rejecting invalid destination address %s

Bad .in-addr.arpa address "%s"; sending error.

Attempt to connect to a .in-addr.arpa address "%s"; sending error.

Connection (fd %d) waiting for pending DNS resolve of %s

Connection (fd %d) found cached answer for %s

Connection (fd %d) found cached error for %s

Launching %s.

Address %s is not pending. Dropping.

First connection (fd %d) no longer waiting for resolve of %s

Connection (fd %d) no longer waiting for resolve of %s

Address %s is not pending but has pending connections!

Address %s is pending but has no pending connections!

Failing all connections waiting on DNS resolve of %s

The cancelled resolve we purged didn't match any in the cache. Tried to purge %s (%p); instead got %s (%p).

Resolved unasked address %s; caching anyway.

Resolved %s which was already resolved; ignoring

The pending resolve we found wasn't removable from the cache. Tried to purge %s (%p); instead got %s (%p).

Unable to stat resolver configuration in '%s': %s

No change to '%s'

Parsing resolver configuration in '%s'

Unable to parse '%s', or no nameservers in '%s' (%d)

Unable to find any nameservers in '%s'.

Unable to find any platform nameservers in your Windows configuration.

eventdns said that %s resolves to ISP-hijacked address %s; treating as a failure.

eventdns said that %s resolves to %s

eventdns returned only non-IPv4 answers for %s.

eventdns returned no addresses or error for %s!

Launching eventdns request for %s

Launching eventdns reverse request for %s

Somehow a malformed in-addr.arpa address reached here.

eventdns rejected address %s: error %d.

Your DNS provider has given "%s" as an answer for %d different invalid addresses. Apparently they are hijacking DNS failures. I'll try to correct for this by treating future occurrences of "%s" as 'not found'.

Your DNS provider tried to redirect "%s" to a junk address. It has done this with %d test addresses so far. I'm going to stop being an exit node for now, since our DNS seems so broken.

Your DNS provider gave an answer for "%s", which is not supposed to exist. Apparently they are hijacking DNS failures. Trying to correct for this. We've noticed %d possibly %s so far.

Testing whether our DNS server is hijacking nonexistent domains with request for bogus hostname "%s"

eventdns rejected test address %s

Bad rep type %d on dns cache hash table

None of the questions we got were ones we're willing to support. Sending NOTIMPL.

Passing request for %s to rewrite_and_attach.

Passed request for %s to rewrite_and_attach.

Error from libevent when adding timer event for %s

Nameserver %s has failed: %s

Nameserver %s is back up

Got a SERVERFAILED from nameserver %s; will allow the request to time out.

Address mismatch on received DNS packet. Address was %s

Error %s (%d) while reading request.

Error %s (%d) while writing response to port; dropping

Error from libevent when adding event for %s

Sending probe to %s

Addrlen %d too long.

Successfully added %s as nameserver

Unable to add nameserver %s: error %d

Could not add nameserver %s to list, error: %d; status: %d

Trying to add nameserver <%s>

Nameserver port <%s> out of range

inet_pton(%s) failed

Resolve requested for %s

Resolve requested for %s (reverse)

Search: trying raw query %s

Search: now trying %s (%d)

Setting ndots to %d

Setting timeout to %d

Setting maximum allowed timeouts to %d

Setting maximum inflight requests to %d

Setting retries to %d

Setting randomize_case to %d

Parsing resolv.conf file %s

Could not open iphlpapi.dll

Found nameservers in %s/%s

Didn't find nameservers in %s/%s

Couldn't open nt key, %d

Couldn't open interfaces key, %d

Couldn't open registry key, %d

Unrecognized accounting unit '%s': only 'month', 'week', and 'day' are supported.

Accounting unit '%s' requires %d %s.

Error initializing keys

Configured hibernation. This interval begins at %s and ends at %s. We have no prior estimate for bandwidth, so we will start out awake and hibernate when we exhaust our quota.

Configured hibernation. This interval began at %s; the scheduled %s %s; %s to exhaust our quota for this interval around %s; the next interval begins at %s (all times local)

Successfully read bandwidth accounting info from state written at %s for interval starting at %s. We have been active for %lu seconds in this interval. At the start of the interval, we expected to use about %lu KB per second. (%I64u bytes read so far, %I64u bytes written so far)

%s; exiting now.

Closing listener type %d

Interrupt: will shut down in %d seconds. Interrupt again to exit now.

Closing conn type %d

Accounting period ended. Commencing hibernation until %s GMT

Accounting period ended. This period, we will hibernate until %s GMT

Commencing hibernation. We will wake up at %s local time.

new conn type %s, socket %d, address %s, n_conns %d.

removing socket %d (type %s), n_conns now %d

Error from libevent setting read event state for %d to unwatched: %s

Error from libevent setting read event state for %d to watched: %s

Error from libevent setting write event state for %d to unwatched: %s

Error from libevent setting write event state for %d to watched: %s

socket %d wants to read.

Unhandled error on read for %s connection (fd %d); removing

socket %d wants to write.

unhandled error on write for %s connection (fd %d); removing

Cleaning up connection (fd %d).

Conn (addr %s, fd %d, type %s, state %d) marked, but wants to flush %d bytes. (Marked at %s:%d)

Flushed last %d bytes from a linked conn; %d left; flushlen %d; wants-to-flush==%d

Holding conn (fd %d) open for more flushing.

We stalled too much while trying to write %d bytes to address %s. If this happens a lot, either something is wrong with your network connection, or something is wrong with theirs. (fd %d, type %s, state %d, marked at %s:%d).

Is your network connection down? Failing connection to '%s:%d'.

I learned some more directory information, but not enough to build a circuit: %s

Expiring wedged directory conn (fd %d, purpose %d)

Expiring non-used OR connection to fd %d (%s:%d) [Too old].

Expiring non-open OR connection to fd %d (%s:%d).

Expiring non-used OR connection to fd %d (%s:%d) [Hibernating or exiting].

Expiring non-used OR connection to fd %d (%s:%d) [idle %d].

Expiring stuck OR connection to fd %d (%s:%d). (%d bytes to flush; %d seconds since last write)

Sending keepalive to (%s:%d)

Rotating onion key.

Your server (%s:%d) has not managed to confirm that its ORPort is reachable. Please check your firewalls, ports, address, /etc/hosts file, etc.

Your server (%s:%d) has not managed to confirm that its DirPort is reachable. Please check your firewalls, ports, address, /etc/hosts file, etc.

Unrecognized signal number %d.

Caught sigpipe. Ignoring.

Rate limiting NEWNYM request: delaying by %d second(s)

In rephist: %I64u used by %d Tors.

Conn %d (socket %d) type %d (%s), state %d (%s), created %d secs ago

Conn %d is to %s:%d.

Conn %d: %d bytes waiting on inbuf (len %d, last read %d secs ago)

Conn %d: %d bytes waiting on outbuf (len %d, last written %d secs ago)

Conn %d: %d/%d bytes used on openssl read buffer; %d/%d bytes used on write buffer.

Average bandwidth: %I64u/%d = %d bytes/sec reading

Average bandwidth: %I64u/%d = %d bytes/sec writing

Clients don't have long-term identity keys. Exiting.

Error initializing keys; can't display fingerprint

Error: missing identity key.

Selected random OS version: %s

libevent call failed: %s [%d]

libevent call returned EINPROGRESS? Please report.

Skipping cached-status file with unexpected name "%s"

Couldn't load networkstatus from "%s"

Couldn't load consensus networkstatus from "%s"

Loaded fallback consensus networkstatus from "%s"

Consensus includes unrecognized authority '%s' at %s:%d (contact %s; identity %s)

Looks like we need to download a new certificate from authority '%s' at %s:%d (contact %s; identity %s)

Consensus does not include configured authority '%s' at %s:%d (identity %s)

%d unknown, %d missing key, %d good, %d bad, %d no signature, %d required

Couldn't write cached network status to "%s"

Network status from %s was published %s in the future (%s GMT). Check your time and date settings! Not caching.

Our clock is %s behind the time published in the consensus network status document (%s GMT). Tor needs an accurate clock to work correctly. Please check your time and date settings!

We received a network status with a fingerprint (%s) that we never requested. (We asked for: %s.) Dropping.

We do not recognize authority (%s) but we are willing to cache it.

Not replacing network-status from %s (published %s); we already have it.

Not replacing network-status from %s (published %s); we have a newer one (published %s) for this authority.

Setting networkstatus %s %s (published %s)

Removing too-old networkstatus in %s

The name %s is listed as Unnamed; it is not the canonical name of any server we know.

There are multiple matches for the nickname "%s", but none is listed as named by the directory authorities. Choosing one arbitrarily.

When looking up a status, you specified a server "%s" by name, but the directory authorities do not have any key registered for this nickname -- so it could be used by any server, not just the one you meant. To make sure you get the same server in the future, refer to it by key, as "$%s".

%s the most recent until %s and will expire at %s; fetching the next one at %s.

Not enough certificates to check networkstatus consensus

This version of Tor (%s) is newer than any recommended version%s, according to the directory authorities. Recommended versions are: %s

Please upgrade! This version of Tor (%s) is %s, according to the directory authorities. Recommended versions are: %s

Unrecognized purpose '%s' when listing router statuses.

Couldn't open advapi32.dll. Are you trying to use NT services on Windows 98? That doesn't work.

Couldn't find %s in advapi32.dll! We probably got the name wrong.

Unsupported command (--list-fingerint, --hash-password, or --verify-config) in NT service.

Illegal command number %d: internal error.

circ (p_circ_id %d) not in list, probably at cpuworker.

Couldn't decrypt onionskin: client may be using old onion key

Adding new entry '%s'

Malformed policy '%s'.

Unexpected result: %d

Unable to parse internally generated policy %s

Removing exit policy %s (%d). It is made redundant by %s (%d).

Removing exit policy %s. It is already covered by %s.

Still had %d address policies cached at shutdown.

Reason for ending (%d) not recognized.

Reason for ending (%d) not recognized; sending generic socks error.

Didn't recognize errno %d (%s); telling the client that we are ending a stream for 'misc' reason.

Unrecognized or_conn reason code %d

Didn't recognize errno %d (%s).

Unrecognized reason code %d

Passing on unrecognized cell.

found conn for stream %d.

delivering %d cell %s.

Sending a RELAY_EARLY cell; %d remaining.

Uh-oh. We're sending a RELAY_COMMAND_EXTEND cell, but we have run out of RELAY_EARLY cells on that circuit. Commands sent before: %s

Address '%s' refused due to '%s'. Considering retrying.

Address '%s' resolved to 0.0.0.0. Closing,

Address '%s' resolved to internal. Closing,

Exitrouter '%s' seems to be more restrictive than its exit policy. Not using this router as exit for now.

Have tried resolving or connecting to address '%s' at %d different places. Giving up.

Edge got end (%s) before we're connected. Marking for close.

'connected' received after %d seconds.

...but it claims the IP address was %s. Closing.

it is! %d

Got a resolve with answer %s. Rejecting.

Got an unexpected relay command %d, in state %d (%s). Dropping.

Now seen %d relay cells here.

Relay begin request unsupported at AP. Dropping.

circ deliver_window now %d.

data cell dropped, unknown stream (streamid %d).

end cell (%s) dropped, unknown stream.

%d: end cell (%s) for stream %d. Removing stream.

'extended' unsupported at non-origin. Dropping.

'truncate' unsupported at origin. Dropping.

'truncated' unsupported at non-origin. Dropping.

'connected' unsupported while open. Closing circ.

circ-level sendme at origin, packagewindow %d.

circ-level sendme at non-origin, packagewindow %d.

stream-level sendme, packagewindow now %d.

resolve request unsupported at AP; dropping.

resolve request on circ with purpose %d; dropping

'resolved' unsupported while open. Closing circ.

Received unknown relay command %d. Perhaps the other side is using a newer version of Tor? Dropping.

called with package_window %d. Skipping.

(%d) Packaging %d bytes (%d waiting).

conn->package_window is now %d

Outbuf %d, Queuing stream sendme.

considering circ->package_window %d

considering layer_hint->package_window %d

%d cells allocated on %d circuits. %d cells leaked.

Query '%s' didn't have valid rend desc in cache. Failing.

Could not find intro key for %s at %s; we have a v2 rend desc with %d intro points. Trying a different intro point...

Internal error: could not find intro key; we only have a v2 rend desc with %d intro points.

Internal error: couldn't hash public key.

Received REND_INTRODUCE_ACK on unexpected circuit %d.

...Found no rend circ. Dropping on the floor.

No introduction points left for %s. Closing.

Got nack for %s from %s. Re-extending circ %d, this time to %s.

Got nack for %s from %s. Building a new introduction circuit, this time to %s.

Sending fetch request for v2 descriptor for service '%s' with descriptor ID '%s', auth type %d, and descriptor cookie '%s' to hidden service directory '%s' on port %d.

Fetching rendezvous descriptor for service %s

Would fetch a new renddesc here (for %s), but one is already in progress.

Fetching v2 rendezvous descriptor for service %s

Malformed service ID %s.

Unknown service %s. Re-fetching descriptor.

No more intro points remain for %s. Re-fetching descriptor.

%d options left for %s.

Incorrect length (%d) on RENDEZVOUS2 cell.

Incorrect digest of key material.

Closing stream for '%s.onion': hidden service is unavailable (try again later).

Unknown router with nickname '%s'; trying another.

Configuration line does not consist of "onion-address authorization-cookie [service-name]": '%s'

Onion address has wrong format: '%s'

Authorization cookie has wrong length: '%s'

Decoding authorization cookie failed: '%s'

Could not compute v2 descriptor ID: Illegal service ID: %s

Could not compute v2 descriptor ID: Replica number out of range: %d

Could not compute v2 descriptor ID: Illegal characters in service ID: %s

Could not write onion key.

Could not write intro key.

Unable to generate random session key to encrypt introduction point string.

Could not encrypt session key for client.

Unrecognized authorization type %d

Could not encode introduction point string to base64. length=%d

Could not write public key to string.

Could not parse my own descriptor: %s

Signature is %d bytes too long on service descriptor.

Removing descriptor with ID '%s' from cache

Descriptor ID contains illegal characters: %s

Service descriptor %s is too old.

Service descriptor %s is too far in the future.

We already have a v2 descriptor for service %s.

We already have a newer service descriptor %s with the same ID and version.

We already have this service descriptor %s.

Successfully stored rend desc '%s', len %d.

Service descriptor with desc ID %s is not in interval that we are responsible for.

Successfully stored service descriptor with desc ID '%s' and len %d.

Parsed %d and added %d descriptor%s.

We already have a v0 descriptor for service ID %s.

Relay cell (rend purpose %d) from wrong hop on origin circ

Dropping cell (type %d) for wrong circuit type.

Received an ESTABLISH_INTRO request on circuit %d

Couldn't decode public key.

Replacing old circuit for service %s

Established introduction point on circuit %d for service %s

Received an INTRODUCE1 request on circuit %d

Rejecting INTRODUCE1 on non-OR or non-edge circuit %d.

Impossibly short INTRODUCE1 cell on circuit %d; responding with nack.

No intro circ found for INTRODUCE1 cell (%s) from circuit %d; responding with nack.

Sending introduction request for service %s from circ %d to circ %d

Received an ESTABLISH_RENDEZVOUS request on circuit %d

Established rendezvous point on circuit %d for cookie %s

Got request for rendezvous from circuit %d to cookie %s.

Tried to complete rendezvous on non-OR or non-edge circuit %d.

Rejecting RENDEZVOUS1 cell with bad length (%d) on circuit %d.

Rejecting RENDEZVOUS1 cell with unrecognized rendezvous cookie %s.

Unable to send RENDEZVOUS2 cell to client on circuit %d.

Completing rendezvous: circuit %d joins circuit %d (cookie %s)

Hidden service with no ports configured; ignoring.

Configuring service with directory "%s"

Service maps port %d to %s:%d

Bad syntax in hidden service port configuration.

Missing or invalid port %s in hidden service port configuration

Unparseable address in hidden service port configuration.

Unparseable or out-of-range port %s in hidden service port configuration.

%s with no preceding HiddenServiceKey directive

HiddenServiceAuthorizeClient contains unrecognized auth-type '%s'. Only 'basic' or 'stealth' are recognized.

HiddenServiceAuthorizeClient contains auth-type '%s', but no client names.

HiddenServiceAuthorizeClient contains %d duplicate client name(s); removing.

HiddenServiceAuthorizeClient contains an illegal client name: '%s'. Length must be between 1 and %d characters.

HiddenServiceAuthorizeClient contains an illegal client name: '%s'. Valid characters are [A-Za-z0-9 -_].

Adding client name '%s'

HiddenServiceAuthorizeClient contains %d client authorization entries, but only a maximum of %d entries is allowed for authorization type '%s'.

Closing intro point %s for service %s.

Loading hidden-service keys from "%s"

Directory name too long to store key file: "%s".

Couldn't compute hash of public key.

Directory name too long to store hostname file: "%s".

Directory name too long to store client keys file: "%s".

Previously stored client_keys file could not be parsed.

Parsed %d previously stored client entries.

Could not open client_keys file %s

Could not open hostname file %s

Error constructing client key

Error generating client key

Generated client key seems invalid

Could not append client entry to file: %s

Could not append host entry to file: %s

No authorization found for descriptor cookie '%s'! Dropping cell!

Client %s authorized for service %s.

Received INTRODUCE2 cell for service %s on circ %d.

Got an INTRODUCE2 over a non-introduction circuit %d.

Got a truncated INTRODUCE2 cell on circ %d.

Got an INTRODUCE2 cell for an unrecognized service %s.

Got an INTRODUCE2 cell for the wrong service (%s).

PK-encrypted portion of INTRODUCE2 cell was truncated.

Wrong auth data size %d, should be %d.

Unknown authorization type number: '%d'

INTRODUCE2 cell is too %s. Discarding.

Bad length %u for version %d INTRODUCE2 cell.

Error decoding onion key in version %d INTRODUCE2 cell.

Couldn't find a nul-padded nickname in INTRODUCE2 cell.

Bad nickname in INTRODUCE2 cell.

Couldn't find router %s named in introduce2 cell.

Bad length %u for INTRODUCE2 cell.

Possible replay detected! We received an INTRODUCE2 cell with same first part of Diffie-Hellman handshake %d seconds ago. Dropping cell.

Internal error: couldn't build DH state or generate public key.

Giving up launching first hop of circuit to rendezvous point %s for service %s.

Accepted intro; launching circuit to %s (cookie %s) for service %s.

Attempt to build circuit to %s for rendezvous has failed too many times or expired; giving up.

Reattempting rendezvous circuit to '%s'

Couldn't relaunch rendezvous circuit to '%s'.

Launching circuit to introduction point %s for service %s

Can't launch circuit to establish introduction at %s.

The intro circuit we just cannibalized ends at $%s, but we requested an intro circuit to $%s. Updating our service.

Unrecognized service ID %s on introduction circuit %d.

Established circuit %d as introduction point for service %s

Couldn't send introduction request for service %s on circuit %d

Unknown service on introduction circuit %d.

Received INTRO_ESTABLISHED cell on circuit %d for service %s

Done building circuit %d to rendezvous with cookie %s for service %s

Couldn't get DH public key.

Not sending publish request for v2 descriptor to hidden service directory '%s'; we don't have its router descriptor. Queuing for later upload.

Sending publish request for v2 descriptor for service '%s' with descriptor ID '%s' with validity of %d seconds to hidden service directory '%s' on port %d.

Sending publish request for hidden service %s

Giving up on %s as intro point for %s.

Could only establish %d introduction points for %s.

Picked router %s as an intro point for %s.

Error launching circuit to node %s for service %s.

Service configured in "%s":

Intro point %d at %s: no circuit

Intro point %d at %s: circuit is %s

beginning to hunt for addr/port

Couldn't find any service associated with pk %s on rendezvous circuit %d; closing.

No virtual port mapping exists for port %d on service %s

Router %s is now Running; it had been down since %s.

Router %s is still Running; it has been Running since %s

Router %s is now Running; it was previously untracked

Router %s is now non-Running: it had previously been Running since %s. Its total weighted uptime is %lu/%lu.

Router %s is now non-Running; it was previously untracked.

Router %s is still non-Running; it has been non-Running since %s.

OR %s [%s]: %ld/%ld good connections; uptime %ld/%ld sec (%.2f%%); wmtbf %lu:lu:lu

Relay '%s' is listed as up in rephist, but it's not in our routerlist. Correcting.

Couldn't scan line %s

Couldn't scan  MTBF line %s

Couldn't scan  WFU line %s

Couldn't hex string %s

Couldn't parse time %s

Could not parse '%s' into a number.'

Expiring predicted port %d

Unknown pk operation %d

PK operations: %lu directory objects signed, %lu directory objects verified, %lu routerdescs signed, %lu routerdescs verified, %lu onionskins encrypted, %lu onionskins decrypted, %lu client-side TLS handshakes, %lu server-side TLS handshakes, %lu rendezvous client operations, %lu rendezvous middle operations, %lu rendezvous server operations.

Error constructing rotated onion key

Error generating onion key

Couldn't write generated onion key to "%s".

Rotating onion key

Couldn't rotate onion key.

Error constructing key

Can't read key from "%s"

Another Tor process has locked "%s". Not writing any new keys.

No key found in "%s"; generating fresh key.

Generated key seems invalid

Generated key seems valid

Couldn't write generated key to "%s".

No key found in "%s"

Error loading private key.

No version 3 directory key found in %s

Signing key found, but no certificate found in %s

Unable to parse certificate in %s

Stored signing key does not match signing key in certificate

Your v3 authority certificate has expired. Generate a new one NOW.

Your v3 authority certificate expires in %d hours; Generate a new one NOW.

Your v3 authority certificate expires in %d days; Generate a new one soon.

We're configured as a V3 authority, but we were unable to load our v3 authority keys and certificate! Use tor-gencert to generate them. Dying.

Reading/making identity key "%s"...

Reading/making onion key "%s"...

Unable to add own descriptor to directory: %s

Dumping fingerprint to "%s"...

Your Tor server's identity key fingerprint is '%s %s'

Configured authority type does not match authority type in DirServer list. Adjusting. (%d v %d)

V3 identity key does not match identity declared in DirServer line. Adjusting.

Adding my own v3 cert

Unable to parse my own v3 cert! Failing.

Advertising DirPort as %d

Not advertising DirPort (Reason: %s)

Testing reachability of my ORPort

Testing bandwidth of my ORPort

Self-testing indicates your ORPort is reachable from the outside. Excellent.%s

ORPort found reachable, but I have no routerinfo yet. Failing to inform controller of success.

Self-testing indicates your DirPort is reachable from the outside. Excellent.

DirPort found reachable, but I have no routerinfo yet. Failing to inform controller of success.

Performing bandwidth self-test...done.

My desc is '%s'

I have no descriptor for the router named "%s" in my declared family; I'll use the nickname as is, but this may confuse clients.

There is a router named "%s" in my declared family, but that isn't a legal nickname. Skipping it.

Our IP Address has changed from %s to %s; rebuilding descriptor (source: %s).

Guessed our IP address as %s (source: %s).

Malformed X-Your-Address-Is header %s. Ignoring.

Got X-Your-Address-Is: %s.

A directory server told us our IP address is %s, but he's just reporting his own IP address. Ignoring.

Tried to sign a router with a private key that didn't match router's public key!

write onion_pkey to string failed!

We just generated a router descriptor we can't parse. Descriptor was: <<%s>>

Parsed certificate for %s

%s for %s that we already have.

Skipping cached certificate

Skipping downloaded certificate

Got a certificate for %s that we already have. Maybe they haven't updated it. Waiting for a while.

%s for directory authority %s with signing key %s

Adding cached certificate

Adding downloaded certificate

%s %s for unrecognized directory authority with signing key %s

cached certificate

downloaded certificate

Updating address for directory authority %s from %s:%d to %s:%d based on in certificate.

Error writing certificates to disk.

We're missing a certificate from authority with signing key %s: launching request.

No current certificate known for authority %s; launching request.

Rebuilding %s cache

Error replacing old router store: %s

We wrote some bytes to a new descriptor file at '%s', but when we went to mmap it, it was empty!

We just removed every descriptor in '%s'. This is okay if we're just starting up after a long time. Otherwise, it's a bug.

Unable to mmap new descriptor file at '%s'.

Couldn't read %s; trying to load routers from old location %s.

Nickname '%s' is misformed; skipping

Nickname list includes '%s' which isn't a known router.

Total weighted bw = %I64u, exit bw = %I64u, nonexit bw = %I64u, exit weight = %lf (for exit == %d), guard bw = %I64u, nonguard bw = %I64u, guard weight = %lf (for guard == %d)

We couldn't find any live%s%s%s routers; falling back to list of all routers.

There are multiple matches for the nickname "%s", but none is listed as named by the directory authorities. Choosing one arbitrarily. If you meant one in particular, you should say %s.

You specified a server "%s" by name, but this name is not registered, so it could be used by any server, not just the one you meant. To make sure you get the same server in the future, refer to it by key, as "$%s".

Descriptor at %p begins with unexpected string %s. Is another process running in our data directory? Exiting.

In %d live descriptors: %I64u bytes. In %d old descriptors: %I64u bytes.

Old descriptor for %s (published %s) %s, %s. Last valid until %s; last served at %s.

Marking router '%s/%s' %s.

Dropping descriptor that we already have for router '%s'

Received a no-longer-recognized descriptor for router '%s'

Skipping not-new descriptor for router '%s'

Replacing entry for router '%s/%s' [%s]

Forgetting obsolete (too old) routerinfo for router '%s'

We have %d live routers and %d old router descriptors.

Router's identity key matches mine; dropping.

Couldn't add router to list: %s Dropping.

Rejected: There is already a named server with this nickname and a different fingerprint.

%d elements to add

We received a router descriptor with a fingerprint (%s) that we never requested. (We asked for: %s.) Dropping.

Marking router %s as never downloadable

Unable to lookup address for directory server at '%s'

There are not many downloadable routerdescs, but we've been waiting long enough (%d seconds). Downloading.

Launching %d request%s for %d router%s, %d at a time

Requesting %d descriptors from authority "%s"

%d router descriptors listed in consensus are currently in old_routers; making them current.

Couldn't add re-parsed router: %s

%d router descriptors downloadable. %d delayed; %d present (%d of those were in old_routers); %d would_reject; %d wouldnt_use; %d in progress.

Extrainfo download status: %d router with no ei, %d with present ei, %d delaying, %d pending, %d downloadable.

%d usable, %d present.

Our directory information is no longer up-to-date enough to build circuits: %s

Country code '%s' is not valid, ignoring.

Country code '%s' is not recognized.

Adding identity %s to %s

Adding nickname %s to %s

Adding country %s to %s

Adding address %s to %s

Entry '%s' in %s is misformed.

We don't have a consensus, so we can't perform v2 rendezvous operations.

Not adding router '%s' to list of responsible hidden service directories, because we have no way of reaching it.

Area for %s has %lu allocated; using %lu.

Checking whether version '%s' is in '%s'

I couldn't parse my own version (%s)

Selected random Tor version: %s

Received directory hashes to %s

Unparseable dir-signing-key token

Dir-signing-key token did not parse as expected

Dir-signing-key token contained no key

Error computing dir-signing-key digest

Listed dir-signing-key is not trusted

Key on %s did not come from an authority; rejecting

Bad object type on %s signature

Error reading %s: invalid signature.

Error reading %s: signature does not match.

Read router '%s', purpose '%s'

%d *distinct* router digests verified

No router keyword found.

Router nickname is invalid

Invalid OR port %s

Invalid dir port %s

bandwidthrate %s unreadable or 0. Failing.

Invalid bandwidthburst %s

Invalid bandwidthcapacity %s

Invalid uptime %s

Couldn't calculate key digest

Couldn't decode router fingerprint %s

Fingerprint '%s' does not match identity digest.

Illegal nickname %s in family line

Invalid extra info digest %s

or_port unreadable or 0. Failing.

Bad nickname %s on "extra-info"

Invalid fingerprint %s on "extra-info"

Invalid published time %s on "extra-info"

No signature found on key certificate

No end-of-signature found on key certificate

Error tokenizing key certificate

Key certificate does not begin with a recognized version (3).

Couldn't decode key certificate fingerprint %s

Digest of certificate key didn't match declared fingerprint

Couldn't parse dir-address in certificate

Certificate didn't end with dir-key-certification.

We already checked the signature on this certificate; no need to do so again.

Invalid nickname %s in router status; skipping.

Error decoding identity digest %s

Error decoding descriptor digest %s

Error parsing time '%s %s'

Error parsing router address in network-status %s

Flags line had a flag %s not listed in known_flags.

Invalid Bandwidth %s

Unknown exit policy summary type %s.

Got a non-v2 networkstatus. Version was %s

Error parsing network-status source address %s

Directory source without dirport; skipping.

Couldn't decode networkstatus fingerprint %s

Couldn't compute signing key digest

network-status fingerprint did not match dir-signing-key

Unrecognized vote status %s in network-status

Bad element '%s' in params

Bad int element '%s' in params

Error decoding identity digest %s in network-status vote.

Mismatch between identities in certificate and vote

Error decoding IP address %s in network-status.

Error decoding vote digest %s in network-status consensus.

Invalid legacy key digest %s on vote.

Error decoding declared identity %s in network-status vote.

Error decoding declared digest %s in network-status vote.

Policy %s is too long.

Error reading address policy: %s

Couldn't parse line %s. Dropping

parse error: %s

parse error: Annotations mixed with keywords

Parse error: missing %s element.

Parse error: too many %s elements.

Parse error: first item is not %s.

Parse error: last item is not %s.

Missing %s [%d] in directory object that should have been validated. Internal error.

couldn't find start of hashed material "%s"

first occurrence of "%s" is not at the start of a line

couldn't find end of hashed material "%s"

cutoff version '%s' unparseable.

Router version '%s' unparseable.

Invalid descriptor ID: '%s'

Unrecognized descriptor version: %s

Invalid secret ID part: '%s'

Secret ID part contains illegal characters: %s

Invalid publication time: '%s'

Could not decrypt session key for client.

Identity digest contains illegal characters: %s

Introduction point onion port %s is invalid

Error tokenizing client keys file.

Impossibly short client key entry.

Illegal client name: %s. (Length must be between 1 and 19, and valid characters are [A-Za-z0-9 -_].)

HiddenServiceAuthorizeClient contains a duplicate client name: '%s'. Ignoring.

Descriptor cookie has illegal length: %s

Descriptor cookie contains illegal characters: %s

Impossibly long IP %s; rejecting

Malformed IP %s in address pattern; rejecting.

Bad number of mask bits (%d) on address range; rejecting.

IPv4-style mask %s is not a prefix address; rejecting.

Malformed mask on address range %s; rejecting.

Unexpected mask in address %s; rejecting

Wanted one port from address range, but there are two.

Unexpected ports in address %s; rejecting

Called with unknown address family %d

unable to create socket: %s

connect() failed: %s

getsockname() to determine interface failed: %s

Port %s out of range

Port %s given on %s when not required

Couldn't look up %s

Malformed port %s on address range; rejecting.

Insane port range on address policy; rejecting.

Mask %s on address range isn't a prefix; dropping

Malformed mask %s on address range; rejecting.

Could not open "%s" for mmap(): %s

File "%s" is empty. Ignoring.

Could not mmap file "%s": %s

Closing a socket (%d) that wasn't returned by tor_open_socket(), or that was already closed or something.

Close returned an error: %s

Our socket count is below zero: %d. Please submit a bug report.

I thought that %d was already open, but socket() just gave it to me!

We do not support more than %lu file descriptors on %s. Tried to raise to %lu.

Could not get maximum number of file descriptors: %s

Couldn't set maximum number of file descriptors: %s

ConnLimit must be at least %d. Failing.

User specified but switching users is unsupported on your OS.

User "%s" not found.

Error %d creating a mutex.

Error %d locking a mutex.

Error %d unlocking a mutex.

Error %d destroying a mutex.

Error freeing condition: %s

Failed to acquire mutex: %d

Error initializing windows network layer: code was %d

crypto error while %s: %s (in %s:%s)

crypto error: %s (in %s:%s)

Using OpenSSL engine %s [%s] for %s

Using default implementation for %s

setting symmetric key

generating RSA key

Error parsing private key

Error reading private key from "%s"

writing RSA key to string

reading public key from string

writing private key

checking RSA key

Error decrypting public-key data

No room for a symmetric key

encoding public key

decoding public key

generating DH key

Weird! Our own DH key was invalid. I guess once-in-the-universe chances really do happen. Trying again.

Weird! pubkey_len (%d) was smaller than DH_BYTES (%d)

DH key must be at least 2.

DH key must be at most p-2.

Rejecting insecure DH key [%s]

DH_compute_key() failed.

Seeding RNG from "%s"

Message from libevent: %s

Warning from libevent: %s

Error from libevent: %s

Message [%d] from libevent: %s

%I64u bytes in %d empty chunks

used chunk: %d items allocated

%I64u/%I64u bytes in %d partially full chunks

%I64u/%I64u bytes in %d full chunks

Gzip not supported with zlib %s

Error from deflateInit2: %s

Gzip compression didn't finish: %s

Error from inflateInit2: %s

Error from second inflateInit2: %s

Gzip decompression returned an error: %s

Gzip returned an error: %s

TLS error while %s%s%s: %s (in %s:%s)

TLS error%s%s: %s (in %s:%s)

TLS error: unexpected close while %s

TLS error:  (errno=%d: %s)

TLS connection closed while %s

OpenSSL %s looks like version 0.9.8l; I will try SSL3_FLAGS to enable renegotiation.

OpenSSL %s [%lx] looks like it's older than 0.9.8l, but some vendors have backported 0.9.8l's renegotiation code to earlier versions, and some have backported the code from 0.9.8m or 0.9.8n. I'll set both SSL3_FLAGS and SSL_OP just to be safe.

OpenSSL %s has version %lx

generating certificate

Error creating certificate

Got a non-version-1 cipher called '%s'

Got a non-version-1 cipher list from %s. It is: '%s'

List was: %s

Cipher %d: %lx %s

Skipping v2 cipher %s

Found cipher %s

Inserting fake %s

Got a TLS renegotiation from %s

read returned r=%d; TLS is closed

read returned r=%d, err=%d

resuming pending-write, (%d to flush, reusing %d)

Server sent back a single certificate; looks like a v2 handshake on %p.

getting peer certificate

Certificate %s: is your system clock set incorrectly?

printing certificate lifetime

(certificate lifetime runs from %s through %s. Your time is %s.)

getting certificate lifetime

Unexpected number of certificates in chain (%d)

No distinct identity certificate found

X509_verify on cert and pkey returned <= 0

checking certificate lifetime

Unhandled OpenSSL errors found at %s:%d:

mallinfo() said: arena=%d, ordblks=%d, smblks=%d, hblks=%d, hblkhd=%d, usmblks=%d, fsmblks=%d, uordblks=%d, fordblks=%d, keepcost=%d

Got invalid RFC1123 time %s

Got invalid RFC1123 time %s: No such month

Got invalid RFC1123 time %s. (Before 1970)

ISO time %s was unparseable

ISO time %s was nonsensical

Got invalid ISO time %s. (Before 1970)

Directory %s cannot be read: %s

Directory %s does not exist.

Creating directory %s

Error creating directory %s: %s

%s is not a directory

Couldn't open "%s" (%s) for writing: %s

Couldn't seek to end of file "%s": %s

Couldn't fdopen "%s" [%d]: %s

Error closing "%s": %s

Error flushing "%s": %s

Error replacing "%s": %s

Error writing to "%s": %s

Could not open "%s": %s

Could not fstat "%s".

Error reading from file "%s": %s

We didn't convert CRLF to LF as well as we hoped when reading %s. Coping.

Could read only %d of %ld bytes of file "%s".

Couldn't find $HOME environment variable while expanding "%s"

Couldn't get homedir for "%s"

pipe failed; exiting. Error was %s

chdir to "%s" failed. Exiting.

Unable to open "%s" for writing: %s

We have only %d/%d usable descriptors.

Only %d descriptor%s here and believed reachable!

Error loading AdvOR.dll in selected process, code:

- attempt to create a non-TCP socket (

There was an error creating AdvOR pipe. If there is another instance of same AdvOR, close it and try again.

Get a list with bridges from https://bridges.torproject.org

Bridges (IP:ORPort [fingerprint]) - each address on a separate line

Use encrypted directory connections (via ORPort instead of DirPort)

All HTTP directory requests will use this proxy:

Proxy account (username:password):

Error loading wininet.dll

The following bridges were downloaded from https://bridges.torproject.org:

&Select port

Local port

Rejecting request for address %s:%u because the exit %s was found in banlist .

Circuit ID %d

Purpose: %s

State: %d (%s)

Created: %s

Hop state: %s

awaiting keys

Country: %s

Address: %d.%d.%d.%d:%d

Router name: %s

Family: %s

Platform: %s

Contact info: %s

The nickname appears to be invalid.

This router claims to be a hidden service directory %s.

Connection type: %s /

State: %s

Address: %s

Actual address: %d.%d.%d.%d

Chosen exit: %s

Process ID: %u

Requested address: %s:%d

Final address: %s:%d

Last socks request: %s

Requested resource: %s

Router purpose: %s

%d routers could not be added.

The router %s from this circuit was found in banlist. Are you sure you want to launch this circuit ?

The router %s from this circuit was not found in router list.

There was an error while opening selected process - code: %d.

Use an existing .onion key

Paste here the private key for your hidden service:

All new connections will appear as originating from IP %d.%d.%d.%d .

All new connections will appear as originating from %s (%s).

&Ban %s (all positions)

Ban %s (e&xit)

Mark router %s as &invalid

Add &entry %s to favorites

A&dd exit %s to favorites

Kill process %s (PID: %u)

The router %s is already marked as invalid.

The router %s was marked as invalid.

- connection request for an address that was not found in AdvOR.dll's onion cache. This can happen when a process is re-intercepted and it keeps its own DNS cache with fake IPs given by previous instances of AdvOR.dll. You can wait until program's cache expires or you can restart the program.

An application is sending junk through AdvOR pipe. The following data was received:

A non-proxy HTTP request was sent for address %s. If your application is intercepted, something is blocking AdvOR.dll (known issue with Nod32).

Error loading plugin %s

The procedure AdvTor_InitPlugin() was not found in %s or it points to an invalid location.

The plugin %s cannot be loaded at this time (initialization failed).

No plugins were found - the directory %s does not exist.

No plugins were found - %s is not a directory.

The plugin %s is currently busy. Do you want to unload it anyway?

[%s] Rejecting request for banned address %s .

Save settings to AdvOR.ini

Unable to automap address %s

[%s] Attempt to use a reserved exclusivity key for a client connection to address %s .

Hot keys

The "Hide/Restore" hot key was unregistered successfully.

The "New Identity" hot key was unregistered successfully.

The "Intercept" hot key was unregistered successfully.

The "Release" hot key was unregistered successfully.

There was an error unregistering the "Hide/Restore" hot key.

There was an error unregistering the "New Identity" hot key.

There was an error unregistering the "Intercept" hot key.

There was an error unregistering the "Release" hot key.

The "Hide/Restore" hot key was registered successfully.

The "New Identity" hot key was registered successfully.

The "Intercept" hot key was registered successfully.

The "Release" hot key was registered successfully.

There was an error registering the "Hide/Restore" hot key.

There was an error registering the "New Identity" hot key.

There was an error registering the "Intercept" hot key.

There was an error registering the "Release" hot key.

The process %s is already intercepted.

The process %s is now intercepted. All new connections will go through the Tor network.

There was an error when trying to intercept some functions from the process %s. This usually happens if AdvOR was started from a restricted account.

Certificate is far too big (at %lu bytes long); rejecting

New password ...

Password

Enter the password that decrypts your configuration data:

Use this password:

Re-enter the password:

The password is a block of 4096 bytes from this file:

Passwords do not match.

Socks4, Socks5, HTTP, HTTPS (autodetected)

Enter exit node associations using this format: address address.exitname.exit

Always use same exits with these addresses until the identity is changed or until the exit association expires (add here addresses of file hosts that expect users to wait, eg.: .rapidshare.com ):

To start hosting a hidden service, start your server software that will host your hidden service and configure it to disable any settings that would cause it to reveal its real location (or, alternatively, you can intercept it). You start hosting a hidden service when you add it to the list of hidden services. Your service will be accessible through its associated .onion address (you may need to configure this .onion address in the server software you use).

The OR network relies on volunteers to donate bandwidth. The more people who run relays, the faster the OR network will be. If you have at least 20 kilobytes/s each way, please help out by configuring Advanced Onion Router to be a relay too. To do this, you must enter a port for your relay (default port is 9050). You are hosting an onion router when directory servers have your address in the list they share for OR clients (they may not immediately update their lists with your service).

Identity-specific generators for HTTP headers and for nicknames use identity seeds to ensure constant values during identity life time.

All processes that had HTTP OR connections and are still active are identified and their cookies and DOM storage (HTML5 cookies) are deleted.

Some websites may use some of Flash Player's features to track their visitors.

Generate new Windows Media Player client ID

Your Windows Media Player client ID is saved to AdvOR-undo.reg and the file is not overwritten. If some licensed material is no longer playable because of changing your unique ID, double click the .reg file to restore it.

Some applications have installed extensions / scripting languages that can be abused to bypass proxy restrictions to reveal your real IP. To make sure an application always uses its proxy settings, the application is intercepted and Winsock calls are redirected to AdvOR.dll.

Enable this option to make sure your real IP is not leaked when the program is using unsupported protocols.

When a program is intercepted its icon is changed by AdvOR.dll to help identifying intercepted processes.

Error opening the registry key %s

Current Windows Media Player client ID: %s

Windows Media Player client ID was saved to %s.

New Windows Media Player client ID: %s

Flash website personalization items deleted:

Flash history items removed from settings.sol :

Called Opera.dll to delete all cookies.

CFHTTPCookieStorageDeleteAllCookies(0): cookies deleted.

Reject requests for *.exitname.exit URL's

Reject requests for *.onion URL's

Remove dangerous HTTP headers (X-Forwarded-For, Client-IP, etc.)

Remove unknown HTTP headers

Show HTTP status

Chrome

Firefox

Opera

Original operating system (Windows)

Identity-dependent Windows (any version)

[%s] HTTP request headers:

[%s] Sending adjusted HTTP headers:

[%s] Downloading from %s

[%s] Received:

[%s] HTTP reply:

[%s] Download status: %s

The application %s is sending unrecognized HTTP headers: "%s"

The application %s is sending dangerous HTTP headers which may uniquely identify you. The headers were removed, but the application may use some extensions which can access this private data. The application sends: "%s"

[%s] Sending:

%s(%I64d) failed with error %s: Rounding up to 1970

%s(%I64d) failed with error %s: Rounding down to 2037

%s(%I64d) failed with error %s: can't recover

Unable to duplicate a %s key: openssl failed.

Called with unknown algorithm %d

I wanted to skip %d chunks in the freelist for %d-byte chunks, but only found %d. (Length %d)

Freelist length for %d-byte chunks may have been messed up somehow.

There were %d chunks at the start. I decided to keep %d. I wanted to free %d. I freed %d. I somehow think I have %d left to free.

Learned fingerprint %s for bridge %s:%d

Not using bridge at %s: it is in ExcludeNodes.

Adjusted bridge '%s' to match configured address %s:%d.

CircuitBuildTime learning is disabled. Consensus=%d, Config=%d, AuthDir=%d

Consensus parameter cbtclosequantile is too small, raising to %d

Consensus parameter cbtinitialtimeout is too small, raising to %d

The Tor Directory Consensus has changed how many circuits we must track to detect network failures from %d to %d.

Config CircuitBuildTimeout too low. Setting to %ds

Rewound history by %d places. Current index: %d. Total: %d

Circuit build time is too large (%u). This is probably a bug.

Adding circuit build time %u

Xm mode #%d: %u %u

The number of circuit times that this Tor version uses to calculate build times is less than the number stored in your state file. Decreasing the circuit time history from %lu to %d.

Replaced timeout %d with %d

We had %d timeouts out of %d build times, and filtered %d above the max of %u

Too many build times in state file. Stopping short before %d

Adding %d timeouts.

Corrupt state file? Build times count mismatch. Read %d times, but file says %d

Corrupt state file? Shuffled build times mismatch. Read %d times, but file says %d

Loaded %d/%d values from %d lines in circuit time histogram

Discrepancy in build times count: %d vs %d

Could not determine largest build time (%d). Xm is %dms and we've abandoned %d out of %d circuits.

Tor now sees network activity. Restoring circuit build timeout recording. Network was down for %d seconds during %d circuit attempts.

Circuit somehow completed a hop while the network was not live. Network was last live at %s, but circuit launched at %s. It's now %s.

Tor has not observed any network activity for the past %d seconds. Disabling circuit build timeout recording.

Got non-live timeout. Current count is: %d

Insanely large circuit build timeout value. (timeout = %fmsec, close = %fmsec)

Circuit build timeout of %dms is beyond the maximum build time we have ever observed. Capping it to %dms.

Your network connection speed appears to have changed. Resetting timeout to %lds after %d timeouts and %d buildtimes.

Circuit build measurement period of %dms is more than twice the maximum build time we have ever observed. Capping it to %dms.

Set buildtimeout to low value %fms. Setting to %dms

Based on %d circuit times, it looks like we don't need to wait so long for circuits to finish. We will now assume a circuit is too slow to use after waiting %ld seconds. Circuit timeout data: %fms, %fms, Xm: %d, a: %f, r: %f

Based on %d circuit times, it looks like we need to wait longer for circuits to finish. We will now assume a circuit is too slow to use after waiting %ld seconds. Circuit timeout data: %fms, %fms, Xm: %d, a: %f, r: %f

Set circuit build timeout to %lds (%fms, %fms, Xm: %d, a: %f, r: %f) based on %d circuit times

Circuit %d (purpose %d, %s) has timed out, yet has attached streams!

Extremely large value for circuit build timeout: %lds. Assuming clock jump. Purpose %d (%s)

Have %d clean circs need another buildtime test circ.

Ancient non-dirty circuit %d is still around after %ld milliseconds. Purpose: %d (%s)

The application request to %s:%d has launched %d circuits without finding one it likes.

Option '%s' used more than once; all but the last value will be ignored.

Can't set a DirPort on a bridge relay; disabling DirPort

Bad OwningControllerProcess: %s

Unix socket path '%s' is too long to fit.

getsockname() couldn't learn address for %s: %s

Invalid proxy protocol, %d

set state %s

The https proxy refused to allow connection to %s (status code %d, %s). Closing.

enter state %s

Invalid proxy_state for reading, %d

leaving state %s

Proxy Client: unable to connect to %s:%d (%s)

Proxy Client: unable to connect to %s:%d

Proxy Client: connection to %s:%d successful

Rejecting request for anonymous connection to private address %s on a TransPort or NATDPort. Possible loop in your NAT rules?

Rejecting SOCKS request for anonymous connection to private address %s

The ".exit" notation is disabled due to security risks. Set AllowTorHosts to 1 or 3 in your configuration to enable it.

Writing %s failed: %s

Control connection %d has taken ownership of this Tor instance.

Owning controller %s has %s -- shutting down.

Owning controller %s has %s -- exiting now.

Couldn't create process-termination monitor for owning controller: %s. Exiting.

Wanted to contact authority '%s' for %s, but it's in our ExcludedNodes list. Skipping.

Wanted to contact directory mirror %s for %s, but it's in our ExcludedNodes list. Skipping. This choice might make your Tor not work.

Rejected vote from %s ("%s").

Invalid line in bandwidth file: %s

Incomplete line in bandwidth file: %s

Double bw= in bandwidth file line: %s

Invalid bandwidth in bandwidth file line: %s

Double node_id= in bandwidth file line: %s

Invalid node_id in bandwidth file line: %s

Node ID %s not found in routerstatus list

Can't open bandwidth file at configured location: %s

Long or truncated time in bandwidth file: %s

Non-integer time in bandwidth file: %s

Bandwidth measurement file stale. Age: %u

Bandwidth measurement file successfully read. Applied %d measurements.

Unable to compute digest of legacy v3 identity key

Couldn't parse IP address "%s"

Insufficient memory for legacy-dir-key line

Bw weight mismatch %d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d Wmd=%d Wme=%d Wmg=%d Wed=%d Wee=%d Wgd=%d Wgg=%d Wme=%d Wmg=%d

Bw Weights error %d for %s v10. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d Wmd=%d Wme=%d Wmg=%d Wed=%d Wee=%d Wgd=%d Wgg=%d Wme=%d Wmg=%d weight_scale=%d

Bw Weights error %d for case %s. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Bw %s: Wgg=%I64d! G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Computed bandwidth weights for %s with v10: G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Computed bandwidth weights for %s with v9: G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d

Bad element '%s' in bw weight param

Couldn't generate a %s consensus at all!

Couldn't parse %s consensus we generated!

Our DNS cache has %d entries. Our DNS cache size is approximately %u bytes.

Unable to rotate keys after IP change!

Couldn't load all cached v3 certificates. Starting anyway.

Couldn't append to journal in %s: %s

Reloaded microdescriptor cache. Found %d descriptors.

Removed %d/%d microdescriptors as old.

Couldn't map file that we just wrote to %s!

Done rebuilding microdesc cache. Saved %d bytes; %d still used.

A consensus needs %d good signatures from recognized authorities for us to accept it. This one has %d (%s).

%d (%s) of the authorities we know didn't sign it.

It has %d signatures from authorities we don't recognize.

%d of the signatures on it didn't verify correctly.

We were unable to check %d of the signatures, because we were missing the keys.

Unrecognized consensus flavor %s

Got consensus with unexpected flavor %s (wanted %s)

Consensus parameter %s is too small. Got %d, raising to %d.

Consensus parameter %s is too large. Got %d, capping to %d.

Value of consensus weight %s was too large, capping to %d

Disabled cell_ewma algorithm because of value in %s

Enabled cell_ewma algorithm because of value in %s; scale factor is %f per %d seconds

No usable introduction points left for %s. Closing.

Re-extending circ %d, this time to %s.

Closing intro circ %d (out of RELAY_EARLY cells).

Marking for close dir conn fetching rendezvous descriptor for service %s

Received service descriptor for service ID %s; expected descriptor for service ID %s.

Another hidden service is already configured for directory %s, ignoring.

The only supported HiddenServiceVersion is 2.

Possible replay detected! We received an INTRODUCE2 cell with same PK-encrypted part %d seconds ago. Dropping cell.

Router %s still seems Running, but its address appears to have changed since the last time it was reachable. I'm going to treat it as having been down for %d seconds

Could not parse value '%s' into a number.'

Could not parse maximum '%s' into a number.'

Writing exit port statistics to disk.

Unable to write exit port statistics to disk!

Written %lu bytes and read %lu bytes to/from an exit connection to port %d.

Opened exit stream to port %d

Attempt to write cell statistics to disk failed. We haven't seen a single circuit to report about.

Can't peform self-tests for this relay: we have listed ourself in ExcludeNodes, and StrictNodes is set. We cannot learn whether we are usable, and will not be able to advertise ourself.%s

Success: chose address '%s'.

Decided to publish new relay descriptor: %s

Empty routerlist passed in to consensus weight node selection for rule %s

Empty routerlist passed in to old node selection for rule %s

Choosing node for rule %s based on weights Wg=%f Wm=%f We=%f Wd=%f with total bw %f

Weighted bandwidth is %f in node selection for rule %s

Round-off error in computing bandwidth had an effect on which router we chose. Please tell the developers. %f %I64u %f

Replacing non-bridge descriptor with bridge descriptor for router %s

Dropping bridge descriptor for %s because we have no bridge configured at that address.

Learned about %s (%s vs %s) from %s's vote (%s)

Unable to parse descriptor of type %s. See file unparseable-desc in data directory for details.

Relay's onion key had invalid exponent.

Invalid Measured Bandwidth %s

Wmm=%f != %I64d

Wem=%f != Wee=%f

Wgm=%f != Wgg=%f

Wed=%f != Weg=%f

Wgg=%f != %I64d - Wmg=%f

Wee=%f != %I64d - Wme=%f

Wgd=%f   Wmd=%f   Wed=%f != %I64d

Bw Weight Failure for %s: Etotal %f != Mtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Rtotal %f > Stotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Rtotal %f > T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Stotal %f > T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*Mtotal %f < T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Etotal %f != Gtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: Mtotal %f != Gtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: NStotal %f != Mtotal %f. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bw Weight Failure for %s: 3*NStotal %f < T %I64d. G=%I64d M=%I64d E=%I64d D=%I64d T=%I64d. Wgg=%f Wgd=%f Wmg=%f Wme=%f Wmd=%f Wee=%f Wed=%f

Bandwidth-weight %s is verified and valid.

Can't parse document with unknown flavor %s

Bad element '%s' in weight params

Error decoding declared signing key digest %s in network-status vote.

Unrecognized algorithm name %s

Multiple digests for %s with %s on detached signatures document

Two signatures with identical keys and algorithm found.

Strange value for circuit build time: %ldmsec. Assuming clock jump. Purpose %d (%s)

The ".onion" notation is disabled due to security risks. Set AllowTorHosts to 2 or 3 in your configuration to enable it.

Delete all SSL certificates that were used with SSL connections and generate new ones. All new connections will use the new SSL context.

There was an error while trying to download a list with bridges - your Internet Explorer may not recognize the authority that signed the certificate for https://bridges.torproject.org .

Do you want to retry ignoring unrecognized certification authorities ?

NTLM connect to '%s' successful! (200).

The NTLM proxy sent back an unexpected status code %d. Closing.

NTLM challenge: %s

The proxy requires an unsupported authentication method.

Account (username:password):

[%s] the server returned an invalid chunk size X

[%s] the client sent an invalid chunk size X

Unable to allocate HTTP authenticator. Not setting BridgePassword.

Got safe cookie authentication response with wrong length (%d)

We have only %d/%d usable exit node descriptors.

Accumulated too much data (%d bytes) on nonopen OR connection to %s:%u in state %s; closing.

Accumulated too much data (%d bytes) on nonopen OR connection from %s:%u in state %s; closing.

The "Hide All" hot key was unregistered successfully.

The "Restore All" hot key was unregistered successfully.

There was an error unregistering the "Hide All" hot key.

There was an error unregistering the "Restore All" hot key.

The "Hide All" hot key was registered successfully.

The "Restore All" hot key was registered successfully.

There was an error registering the "Hide All" hot key.

There was an error registering the "Restore All" hot key.

Rejecting null address with 0 port (family %d)

User:password

Generate an .onion address

You have entered a prefix for your new .onion address.

Bypass Tor blacklists

Some ideas for improving this feature include injecting public proxies after the exit node and opening more connections through different exit nodes to the same target in case the target doesn't flood the blacklist server with requests. Use our forums to post your suggestions for improving AdvOR's blacklist bypass abilities.

Enabling hidden service key %i (%s.onion)

Disabling hidden service key %i (%s.onion)

There is an error in default language file definitions, %d %s

Expected index: %d

%s-plugins\%s

-%s.lng

Error loading language file %s

Loaded language definitions %d

Format error in definition d:

Expected: %s

Found: %s

Windows 2000 Service Pack 4 [workstation]

Windows 2000 Service Pack 4 [server] {enterprise} {terminal services, single user} {terminal services}

Windows XP Service Pack 1 [workstation] {terminal services, single user}

Windows XP Service Pack 2 [workstation] {terminal services, single user}

Windows XP Service Pack 3 [workstation] {terminal services, single user}

Windows XP Service Pack 3 [workstation] {personal} {terminal services, single user}

Windows Server 2003 Service Pack 1 [server] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 1 [domain controller] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {enterprise} {terminal services}

Windows Server 2003 Service Pack 2 [server] {"blade" (2003, web edition)} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {datacenter} {enterprise} {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [server] {terminal services, single user} {terminal services}

Windows Server 2003 Service Pack 2 [domain controller] {enterprise} {terminal services, single user} {terminal services}

Windows "Longhorn" [workstation] {terminal services, single user}

Windows "Longhorn" Service Pack 1 [workstation] {terminal services, single user}

Windows "Longhorn" Service Pack 1 [server] {datacenter} {terminal services, single user} {terminal services}

Windows "Longhorn" Service Pack 1 [server] {terminal services, single user} {terminal services}

Windows "Longhorn" Service Pack 2 [workstation] {personal} {terminal services, single user}

Windows "Longhorn" Service Pack 2 [server] {"blade" (2003, web edition)} {terminal services, single user} {terminal services}

Very recent version of Windows [major=6,minor=1] [workstation] {terminal services, single user}

16:%s

Kernel32.dll

EXEC %s

?@last-listed %s

fast_memeq(md->body, "onion-key", 9)

cached-microdescs.new

CLOCK_SKEW MIN_SKEW=%ld SOURCE=NETWORKSTATUS:%s:%d

router_get_consensus_status_by_nickname

DANGEROUS_VERSION CURRENT=%s REASON=%s RECOMMENDED="%s"

dest_router_key

crypto_dh_get_bytes(handshake_state) == DH_KEY_LEN

%s:%s=

%s--%s

%s (%s)

%s %u

%s\*.dll

http://

https://

SOCKS_UNKNOWN_PROTOCOL DATA="%s"

HTTP/1.0 200 Connection established

ftp://

DANGEROUS_SOCKS PROTOCOL=SOCKS5 ADDRESS=%s:%d

DANGEROUS_SOCKS PROTOCOL=SOCKS4 ADDRESS=%s:%d

PID: %u, ID: %x

Remaining chunk: %x

Trailer: %x

conn->_base.state == AP_CONN_STATE_SOCKS_WAIT

Windows NT 5.0

Windows NT 5.1

Windows NT 5.2

Windows NT 6.0

Windows NT 6.1

x-operamini

proxy_http.c

Windows; U;

Mozilla/5.0 (

) AppleWebKit/

windows nt

Opera/9.80 (

Mozilla/5.0 (compatible; MSIE

%i Firefox/

(KHTML, like Gecko) Chrome/

Opera/9.i (

(.NET CLR 3.5.30729)

WebMoney Advisor

( .NET CLR 3.5.30729; .NET4.0C)

( .NET CLR 3.5.30729; .NET4.0E)

( .NET CLR 3.5.30729)

; YPC 3.2.0

; WebMoney Advisor

; FunWebProducts

Mozilla/4.0 (compatible; MSIE

; .NET CLR 2.0.50727

; .NET CLR 3.0.04506.30

; .NET CLR 1.1.4322

; .NET CLR 3.0.04506.648

; .NET CLR 3.0.30729

; .NET CLR 3.5.21022

Unrecognized response headers: %s

%s%s%s%s%s

Mozilla/5.0 (compatible; Yahoo! Slurp; http://help.yahoo.com/help/us/ysearch/slurp)

Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots)

[email protected]

bingbot(at)microsoft.com

msnbot/2.0b ( http://search.msn.com/msnbot.htm)

googlebot(at)googlebot.com

Mozilla/5.0 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)

Opera/

Firefox/

Chrome/

Browser: Opera

Browser: Firefox

Browser: Chrome

Changing host from %s to %s

HTTP/1.1 302 Found

Location: %s

x-orig-url:

x-opera-id:

x-opera-info:

x-opera-host:

0.0.0.0/8

169.254.0.0/16

127.0.0.0/8

192.168.0.0/16

10.0.0.0/8

172.16.0.0/12

%s%s%s %s

:%d-%d

reject %s:*

%d-%d

splice->_base.purpose == CIRCUIT_PURPOSE_REND_ESTABLISHED

introduction-point %s

ip-address %s

onion-port %d

%sservice-key

rendezvous-service-descriptor %s

permanent-key

%ssecret-id-part %s

publication-time %s

protocol-versions %s

%s-----END MESSAGE-----

service_key

circ->_base.purpose == CIRCUIT_PURPOSE_C_INTRODUCING

circ->_base.purpose == CIRCUIT_PURPOSE_C_ESTABLISH_REND

rendcirc->_base.purpose == CIRCUIT_PURPOSE_C_REND_READY

introcirc->_base.purpose == CIRCUIT_PURPOSE_C_INTRODUCING

parse_port_config

.dll:0

!strcasecmp(line->key, "HiddenServiceVersion")

rend_service_load_keys

client-name %s

descriptor-cookie %s

client-key

%s.onion %s # client: %s

oldcirc->_base.purpose == CIRCUIT_PURPOSE_S_CONNECT_REND

circuit->_base.purpose == CIRCUIT_PURPOSE_S_ESTABLISH_INTRO

circuit->_base.purpose == CIRCUIT_PURPOSE_S_CONNECT_REND

!crypto_pk_generate_key(intro->intro_key)

rend_service_set_connection_addr_port

circ->_base.purpose == CIRCUIT_PURPOSE_S_REND_JOINED

%i %s:%i

set_hs_key

(!at_addr && !at_port) || (at_addr && at_port)

%s [%s](%ld/%ld);

stored-at %s

 MTBF %lu %.5lf%s%s

 WFU %lu %lu%s%s

last-downrated %s

tracked-since %s

%s%s%s%s%s%swfu %0.3lf

total-run-weights %f

router %s %s %s

relevant-flags %s%s%s

router %s {no descriptor}

 MTBF %lu %lf S=s %8s

 WFU %lu %lu S=s %8s

@s %ld %lf S=s %8s

%s %s (%d s)

rep_hist_note_used_port

predicted_ports_list

predicted_ports_times

rep_hist_get_predicted_ports

exit-stats-end %s (%d s)

exit-kibibytes-written %s

exit-kibibytes-read %s

exit-streams-opened %s

%d=%I64u

%d=%u

other=%u

cell-stats-end %s (%d s)

cell-processed-cells %s

cell-queued-cells %s

cell-time-in-queue %s

cell-circuits-per-decile %d

get_onion_key

onionkey

dup_onion_keys

assert_identity_keys_ok

0!=crypto_pk_cmp_keys(client_identitykey, server_identitykey)

0==crypto_pk_cmp_keys(client_identitykey, server_identitykey)

server_identitykey

client_identitykey

get_server_identity_key

get_tlsclient_identity_key

rotate_onion_key

rotated onion key

init_key_from_file

load_authority_keyset

decide_to_advertise_dirport

EXTERNAL_ADDRESS ADDRESS=%s METHOD=DIRSERV

Tor %s on %s

router %s %s %d 0 %d

platform %s

opt fingerprint %s

bandwidth %d %d %d

%s%s%s%sonion-key

%ssigning-key

extra-info %s %s

is_legal_nickname

!body[desc_routerinfo->cache_info.signed_descriptor_len]

desc_routerinfo->cache_info.saved_location == SAVED_NOWHERE

init_keys

set onion key

strlen(options->Nickname) <= MAX_NICKNAME_LEN

router_dirport_found_reachable

REACHABILITY_SUCCEEDED DIRADDRESS=%s:%d

DirPort found reachable

router_orport_found_reachable

ORPort found reachable

REACHABILITY_SUCCEEDED ORADDRESS=%s:%d

%s: %s:%d.

trusted_dirs_flush_certs_to_disk

authority_cert_get_all

certs_out

router_nickname_is_in_list

router_get_by_nickname

"$%s" for the one at %s:%d

trusted_dirs_load_certs_from_string

ri->cache_info.routerlist_index == -1

tor_memeq(r->cache_info.identity_digest, d, DIGEST_LEN)

r->cache_info.routerlist_index == r_sl_idx

tor_memeq(ei->cache_info.signed_descriptor_digest, d, DIGEST_LEN)

tor_memeq(ei->cache_info.signed_descriptor_digest, sd->extra_info_digest, DIGEST_LEN)

authority_certs_fetch_missing

directory server "%s" at %s:%d

directory server at %s:%d

ri_new->cache_info.routerlist_index == -1

@purpose %s

Router's identity key matches mine.

Extrainfo signature was bad, or signed with wrong key.

Extrainfo nickname or identity did not match routerinfo

Extrainfo signature bad, or signed with wrong key

Contact %s, Platform %s

We have only %d/%d usable entry node descriptors.

add_nickname_list_to_smartlist

%s%.2f GB

%s%d B

%s%.2f kB

%s%.2f MB

D[%s%s] %d.%d.%d.%d (%s)

onion-port

service-key

signing-key

dir-key-certificate-version

dir-identity-key

dir-key-published

dir-key-expires

dir-key-crosscert

dir-key-certification

legacy-dir-key

Unable to parse descriptor of type %s:

_find_by_keyword

dir_signing_key_is_trusted

pkey

Wrong size on key for %s: %d bits

Too many arguments to %s

Missing public key for %s

Missing object for %s

Unexpected public key for %s

Too few arguments to %s

Private key given for %s, which wants a public key

Far too many arguments to %s

Unexpected object for %s

Malformed object: mismatched end tag %s

Public key given for %s, which wants a private key

RSA PUBLIC KEY

RSA PRIVATE KEY

Couldn't parse private key.

Couldn't parse public key.

find_dir_signing_key

opt dir-signing-key

authority_cert_parse_from_string

K_DIR_SIGNING_KEY

K_DIR_IDENTITY_KEY

authority cert

K_DIR_KEY_PUBLISHED

K_DIR_KEY_EXPIRES

tok->key

key certificate

key cross-certification

K_ONION_KEY

0.2.0.1-alpha

0.2.0.0-alpha-dev (r10070)

0.2.0.8-alpha

0.2.1.1-alpha

%s >= %s

Unknown digest algorithm %s; skipping

strlen(router->cache_info.signed_descriptor_body) == len

K_SIGNING_KEY

0.1.2.2-alpha

cp (end-start_of_annotations) == router->cache_info.signed_descriptor_body len

R_PERMANENT_KEY

R_IPO_ONION_PORT

R_IPO_ONION_KEY

R_IPO_SERVICE_KEY

rend_parse_client_keys

EXCEPTION_FLT_DENORMAL_OPERAND

EXCEPTION_FLT_INVALID_OPERATION

[%s]:

Unknown state: X, len: X

[%s%s%s%s]: X, len: X

FREE: X, len: X

RESERVED: X, len: X

[X:%i] X[X] ([%s%s%s%s]: X, len: X)

Previous: [X:%i] X[X]

Sentinel overwritten with X

No read access: X, len: X

BIG FUCKING ERROR X

AdvOR version: %s

Exception code: %s

Exception code: X

Address: X

Cause: %s address: X

EAX=X

EBX=X

ECX=X

EDX=X

CS =X

DS =X

ES =X

SS =X

ESI=X

EDI=X

EBP=X

ESP=X

DR0=X

DR1=X

DR2=X

DR3=X

DR6=X

DR7=X

FS =X

GS =X

EIP=X

EFlags=X

Do you want to save a crash report ?

Advanced Onion Router 0.3.0.20 - Error

%sX

dbghelp.dll

imagehlp.dll

[%s] %s%sPC=X, Return = X, SP=X, Params: X, X, X, X

AdvOR-crash.txt

Operation now in progress [WSAEINPROGRESS ]

Operation already in progress [WSAEALREADY ]

Socket operation on nonsocket [WSAENOTSOCK ]

Message too long [WSAEMSGSIZE ]

Protocol not supported [WSAEPROTONOSUPPORT ]

Socket type not supported [WSAESOCKTNOSUPPORT ]

Operation not supported [WSAEOPNOTSUPP ]

Protocol family not supported [WSAEPFNOSUPPORT ]

Address family not supported by protocol family [WSAEAFNOSUPPORT ]

Winsock.dll out of range [WSAVERNOTSUPPORTED ]

Windows

%3u.%3u.%3u.%3u%c

::%d.%d.%d.%d

::%x:%d.%d.%d.%d

Windows 8

Windows 7

Windows Vista

Windows Server 2003

Windows XP

Windows 2000

Windows Me

Windows 98

Windows NT 3.51

Bizarre version of Windows where GetVersionEx doesn't work.

Unrecognized version of Windows [major=%d,minor=%d] %s

Very recent version of Windows [major=%d,minor=%d] %s

Windows NT 4.0

Windows 95

Unable to lock memory pages. mlockall() unsupported?

%u.%u.%u%c%c

%u.%u%c%c

2.0.21-stable

[d-d-d d:d:d] [%s]

%s():

[...truncated]

Allocated memory: %u buffers, %u bytes

___, %d ___ %Y %H:%M:%S GMT

tm.tm_wday >= 0

tm.tm_mon <= 11

tm.tm_mon >= 0

tm.tm_wday <= 6

%Y-%m-%d %H:%M:%S

[%d similar message(s) suppressed in last %d seconds]

key_out

parse_http_time

%2u %3s %4u %2u:%2u:%2u GMT

%2u-%3s-%2u %2u:%2u:%2u GMT

%3s %3s %2u %2u:%2u:%2u %4u

%u-%2u-%2u %2u:%2u:%2u

%3s, %2u %3s %u %2u:%2u:%2u GMT

%d.%d.%d.%d.in-addr.arpa

.in-addr.arpa

.ip6.arpa

ip6.arpa

parse_port_range

port_max_out

port_min_out

tor_addr_parse_mask_ports

port > mask

tor_addr_port_parse

parse_addr_port

addrport

parse_addr_and_port_range

%d.%d.%d.%d

smartlist_join_strings2